SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005383 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005383
Domain Number 1 Region: 30-228
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.06e-42
Family Laminin G-like module 0.0027
Further Details:      
 
Domain Number 2 Region: 478-589
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000275
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number 3 Region: 432-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000883
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 268-332
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000115
Family VWC domain 0.016
Further Details:      
 
Domain Number 5 Region: 688-760
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000607
Family VWC domain 0.01
Further Details:      
 
Domain Number 6 Region: 595-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000241
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000005383
Domain Number - Region: 333-397
Classification Level Classification E-value
Superfamily FnI-like domain 0.000534
Family VWC domain 0.091
Further Details:      
 
Domain Number - Region: 398-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005383   Gene: ENSPANG00000013992   Transcript: ENSPANT00000009700
Sequence length 816
Comment pep:known_by_projection chromosome:PapAnu2.0:11:40155342:40522784:-1 gene:ENSPANG00000013992 transcript:ENSPANT00000009700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESWVLLRTFCLIFGLGAVWGLGVDPSLQIDVLSELELGESTTGVRQVPGLHNGTKAFLF
QDTPRSIKASTATAEQFFQKLRNKHEFTILVTLKQTHLNSGVILSVHHLDHRYLELESSG
HRNEVRLHYRSGSHRPHTEVFPYILADDKWHKLSLAISASHLILHIDCNKIYERVVEKPS
TDLPLGTTLWLGQRNNAHGYFKGIMQDVQLLVMPQGFIAQCPDLNRTCPTCNDFHGLVQK
IMELQDILAKTSAKLSRAEQRMNRLDQCYCERTCTMKGTTYREFESWTDGCKNCTCLNGT
IQCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERSTVYSSSGVCVLYE
CKDQTMKLVESSGCPALDCPESQQITLSHSCCKVCKGYDFCSERHNCMENSVCRNLNDRA
VCSCRDGFRALREDNAYCEDIDECAEGRHYCRENTMCVNTPGSFMCICKTGYIRIDDYSC
TEHDECITNQHNCDENALCFNTVGGHNCVCKPGYTGNGTTCKAFCKDGCRNGGACIAANV
CACPQGFTGPSCETDIDECSDGFVQCDSRANCINLPGWYHCECRDGYHDNGMFSPSGESC
EDIDECGTGRHSCANDTICFNLDGGYDCRCPHGKNCTGDCIHDGKVKHNGQIWVLENDRC
SVCSCQNGFVMCRRMVCDCENPTVDLFCCPECDPRLSSQCLHQNGETLYNSGDTWVQNCQ
QCRCLQGEVDCWPLPCPDVECEFSILPENECCPRCVTDPCQADTIRNDITKTCLDEMNVV
RFTGSSWIKHGTECTLCQCKNGHICCSVDPQCLQEL
Download sequence
Identical sequences A0A096MZI4 A0A2K5KZ99 A0A2K5YPV6 A0A2K6C8M9 F7GWK3 G7PHM9
ENSMMUP00000022735 ENSMMUP00000039924 9544.ENSMMUP00000022735 NP_001248688.1.72884 XP_005570684.1.63531 XP_011720152.1.29376 XP_011827386.1.47321 XP_011827387.1.47321 XP_011903990.1.92194 XP_015006958.1.72884 XP_015006959.1.72884 XP_015286264.1.63531 ENSMMUP00000022735 ENSPANP00000005383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]