SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005398 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005398
Domain Number 1 Region: 187-346
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.94e-45
Family Calpain large subunit, catalytic domain (domain II) 0.0000225
Further Details:      
 
Domain Number 2 Region: 354-532
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 6.93e-40
Family Calpain large subunit, middle domain (domain III) 0.0000384
Further Details:      
 
Domain Number 3 Region: 51-151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.04e-32
Family Galectin (animal S-lectin) 0.00000273
Further Details:      
 
Domain Number 4 Region: 551-714
Classification Level Classification E-value
Superfamily EF-hand 9.45e-25
Family Penta-EF-hand proteins 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005398   Gene: ENSPANG00000009955   Transcript: ENSPANT00000006328
Sequence length 719
Comment pep:known_by_projection chromosome:PapAnu2.0:19:33006543:33044074:-1 gene:ENSPANG00000009955 transcript:ENSPANT00000006328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVYKMSMRDSPVCQAVGRQGWRGGGTRSLLCCPQQSPAPRLPDPVPAMSNVPHKSLLPE
GIRPGTVLRIRGLVPPNAGRFHVNLLCGEEQDSDAALHFNPRLDTSEVVFNSKEQGSWGR
EERGPGVPFQRGQPFEVLIIASDDGFKVTAGSLRPPPPLLCIPGSCAGWSLLDRISSMAT
QVSSTSRLHGSYEVMRGGHMNEAFVDFTGGVGEVLYLRQNSMGLFSALRHALAKESLVGA
TALSDRGECRTEEGLVKGHAYSVTGTHKVFLGFTKVRLLRLRNPWGRVEWTGAWSDSCPR
WDALPTECRDALLVKKEDGEFWMELRDFLLHFDTVQICSLSPEVLGPSPEWGGWHVHTFQ
GRWVRGFNSGGSQPSAETFWTNPQFRLTLLEPDEEEDEDEEGPWGGWGASGAWGPARGGR
TLKCTVLLSLTQRNRRRLRAKGLTYLTVGFHVFQIPEELLGLWDSPRSRALLPRLLRADR
SPLSARRDVSRRCRLRPGHYLVVPSTAHAGDEADFTLRVFSERRHTAVEIDDVISADLQA
LQGPYLPLELDLEQLFKELAGEEEELNASQLQALLSIALEPARVHTHTPREIGLRTCEQL
LQCFGHGQSLALHHFQQLWGHLLEWQAIFHKFDEDASGTMNSYELRLALNAAGFHLNNQL
TQALTSRYRDSRLRVDFERFVSCVAQLTCIFCHCSQHLDGGEGVICLTHRQWMEAATFS
Download sequence
Identical sequences ENSPANP00000005398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]