SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005454 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005454
Domain Number 1 Region: 17-65
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000042
Family SH3-domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000005454
Domain Number - Region: 450-534
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00818
Family PLC-like (P variant) 0.037
Further Details:      
 
Domain Number - Region: 600-653,763-864
Classification Level Classification E-value
Superfamily ARM repeat 0.046
Family MIF4G domain-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005454   Gene: ENSPANG00000023666   Transcript: ENSPANT00000009113
Sequence length 874
Comment pep:novel chromosome:PapAnu2.0:3:133941612:134101961:-1 gene:ENSPANG00000023666 transcript:ENSPANT00000009113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHSISLFSPVSSFIASFRGTVPYGLSLEIGDTVQILEKCDGWYRGFALKNPNIKGIFPS
SYVHLKNACVKNKGQFEMVIPTEDSVITEMTSTLRDWGTMWKQLYVRNEGDLFHRLWHIM
NEILDLRRQVLVGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKEYAMVDPEDISITE
LYRLMEHRHRKKDTPVQASSHHLFVQMKSLMCSNLGEELEVIFSLFDSKENRPISERFFL
RLNRNGLPKAPDKPERHCSLFVDLGSSELRKDIYITVHIIRIGRMGAGEKKNACSVQYRR
PFGCAVLSIADLLTGETKDDLILKVYMCNTESEWYQIHENIIKKLNARYNLTGSNAGLAV
SLQLLHGDIEQIRREYSSVFSHGVSITRKLGFSNIIMPGEMRNDLYITIERGEFEKGGKS
VARNVEVTMFIVDSSGQTLKDFISFGSGEPPASEYHSFVLYHNNSPRWSELLKLPIPVDK
FRGAHIRFEFRHCSTKEKGEKKLFGFSFVPLMQEDGRTLPDGTHELIVHKCEENTNLQDT
TRYLKLPFSKGIFLGNNNQAMKATKESFCITSFLCSTKLTQNGDMLDLLKWRTHPDKITG
CLSKLKEIDGSEIVKFLQDTLDTLFGILDENSQKYGSKVFDSLVHIINLLQDSKFHHFKP
VMDTYIESHFAGALAYRDLIKVLKWYVDRITEAERQEHIQEVLKAQEYIFKYIVQSRRLF
SLATGGQNEEEFRCCIQELLMSVRFFLSQESKGSGALSQSQAVFLSSFPAVYSELLKLFD
VREVANLVQDTLGSLPTILHVDDSLQAIKLQCIGKTVESQLYTNPDSRYILLPVVLHHLH
IHLQEQKDLIMCARILSNVFCLIKKNSSVSKYRS
Download sequence
Identical sequences ENSPANP00000005454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]