SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005472 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005472
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 2.92e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000041
Further Details:      
 
Domain Number 2 Region: 236-324
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.44e-30
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000184
Further Details:      
 
Domain Number 3 Region: 384-444
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000111
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005472   Gene: ENSPANG00000005276   Transcript: ENSPANT00000001165
Sequence length 456
Comment pep:known_by_projection chromosome:PapAnu2.0:X:45693586:45701080:1 gene:ENSPANG00000005276 transcript:ENSPANT00000001165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGD
DCQAGLNFADEGEAQAFRALVQEKIQKRNQRQSGDRRQLLPPPPPANEERRGGLPPLPPH
PGGDQGVGTWVGGWADGQSHSLILAPQSLSGQERARGLHYERREGRAVGIHWSLFTSPRH
VTHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQE
MRRQEPLPPPPPPSRGGNQPPRPPIVGGNKGRSGPLPPVPLGGRGGPLPPPPPATGRSSS
GNGPAPPLLPPALVPAGGLAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGL
VGALMHVMQKRSRAIHSSDEGEDQAGDEDEDDEWDD
Download sequence
Identical sequences ENSPANP00000005472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]