SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005717 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005717
Domain Number 1 Region: 281-412
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000785
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 407-450
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000227
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 3 Region: 483-522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000159
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 4 Region: 251-293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000493
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 5 Region: 5-37
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000035
Family EGF-type module 0.011
Further Details:      
 
Domain Number 6 Region: 442-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000407
Family EGF-type module 0.026
Further Details:      
 
Domain Number 7 Region: 219-251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000082
Family EGF-type module 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005717   Gene: ENSPANG00000007576   Transcript: ENSPANT00000013985
Sequence length 639
Comment pep:known_by_projection chromosome:PapAnu2.0:12:91177630:91413049:-1 gene:ENSPANG00000007576 transcript:ENSPANT00000013985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLVADPCASNPCHHGNDGYLCLCNEGYEGPNCEQALPSLPATGWTESMAPRQLQPVPATQ
EPDKILPHSQATVTLPTWQPKTGQKVVEMKWDQVEVIPDIACGNASSNSSAGGRLVTFEV
PQNTSVKIRQDATASLILLWKVTATGFQQCSLIDGRSVTPLGLSGSFMWLFETVLVGDKP
HFLLGFVNDSVTKSIVALRLTLVVKVSTCVPGESHANDLECSGKGKCTTKPSEATFSCTC
EEQYVGTFCEEYDACQRKPCQNNASCIDANEKQDGNNFTCVCLPGYTGELCQSKIDYCIL
DPCRNGATCISSLSGFTCQCPEGYFGSACEEKVDPCASSPCQNNGTCYVDGVHFTCSCSS
GFTGPTCAQLIDFCALSPCAHGTCHSVGTSYKCLCDPGYHGLYCEEEYNECLSAPCLNAA
TCRDLVNGYECVCLAEYKGTHCELYKDPCANVSCLNGATCDSDGLNGTCICAPGFTGEEC
DIDINECDSNPCHHGGSCLDQSNGYTCHCPHGWVGANCEIHLQWKSGHMAESLTNMPRHS
LYIIIGALCVAFILMLIILIVGICRISRIEYQGSSRPAYEEFYNCRSIDSEFSNAIASIR
HARFGKKSRPAMYDVSPIAYEDYSPDDKPLVTLIKTKDL
Download sequence
Identical sequences ENSPANP00000005717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]