SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005783 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005783
Domain Number 1 Region: 180-194,283-323,378-590
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.06e-55
Family Nuclear receptor ligand-binding domain 0.00011
Further Details:      
 
Domain Number 2 Region: 112-193
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-29
Family Nuclear receptor 0.0000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005783   Gene: ENSPANG00000006162   Transcript: ENSPANT00000027739
Sequence length 603
Comment pep:known_by_projection chromosome:PapAnu2.0:11:94440639:94484495:-1 gene:ENSPANG00000006162 transcript:ENSPANT00000027739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATIEEIAHQIIEQQMGEIVTEQQTGQKIQIVTALDHNTQGKQFILTNHDGSTPSKVILA
RQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSSPDQGPNKVFDLCVVCGDK
ASGRHYGAVTCEGCKGFFKRSIRKNLVYSCRGSKDCIINKHHRNRCQYCRLQRCIAFGMK
QDSVQCERKPIEVSREKSSNCAASTEKIYIRKDLRSPLTATPTFVTDSETTRSTGLLDSG
MFVNIHPSGVKTESTVLMTSDKAESCQGDLSTLASVVTSLANLGKTKDLSQNSNEMSMIE
SLSNDDTSLCEFQEMQTNGDVSSAFPTLSLSFKYDKNTLKNNSLTRMEGSVHLITGDSSI
NYTEKEGPLLSDSHVAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALGQ
ENSISLVKAYWNEFTLGLAQCWQVMNVATILATFVNCLHNSLQQGKMSTERRKLLMEHIF
KLQEFCNSMVKLCIDGYEYAYLKAIVLFSPDHPGLENMEQIEKFQEKAYVEFQDYITKTY
PDDTYRLSRLLLRLPALRLMNATITEELFFKGLIGNIRIDSVIPHILKMEPADYNSQIIG
HSI
Download sequence
Identical sequences ENSPANP00000005783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]