SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005845 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005845
Domain Number 1 Region: 867-919
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000145
Family Laminin-type module 0.0033
Further Details:      
 
Domain Number 2 Region: 335-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000103
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 3 Region: 821-869
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000586
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 4 Region: 773-814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000642
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 5 Region: 271-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000921
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 6 Region: 976-1027
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family Laminin-type module 0.0032
Further Details:      
 
Domain Number 7 Region: 510-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.0092
Further Details:      
 
Domain Number 8 Region: 928-978
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000474
Family EGF-type module 0.08
Further Details:      
 
Domain Number 9 Region: 458-502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Laminin-type module 0.008
Further Details:      
 
Domain Number 10 Region: 1084-1126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000977
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 11 Region: 415-460
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000363
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 12 Region: 1028-1081
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000809
Family Laminin-type module 0.0026
Further Details:      
 
Domain Number 13 Region: 1132-1179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000949
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 14 Region: 1538-1662
Classification Level Classification E-value
Superfamily Prefoldin 0.0000251
Family Prefoldin 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005845   Gene: ENSPANG00000025367   Transcript: ENSPANT00000023217
Sequence length 1786
Comment pep:known_by_projection chromosome:PapAnu2.0:3:130080774:130166722:-1 gene:ENSPANG00000025367 transcript:ENSPANT00000023217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLQVLAFSFLALCGARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQRLSVTSTCGLHK
PEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVEN
VTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTG
PMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKL
HTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMC
RHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVYLATGNVSGG
VCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTG
LIAGQCRCKLHVEGEHCDVCKEGFYDLSGEDPFGCKSCACNPLGTIPGGNPCDSETGHCY
CKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCSAESGQCSCRPHMIGRQC
NEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFF
IDDIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGKIPPSSRCGNTIPDDDNQVVSLSPG
SRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGG
SGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGS
LSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKACECHLQGSVNAFCNPVTGQC
HCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLA
GYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCAS
GFFGNPSEVGGLCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDA
LRQDCRKCVCNYLGTVQEHCNGSDCQCDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTG
CDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIE
TPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRF
LEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDV
TEMTAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDS
ITKYFQMSLEAEERVNASTTQPNSTVEQSALMRDRVEDVMMERESQFKEKQEEQARLLDE
LAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTDEGEKKCGGPGCGGLVTVAHNA
WQKAMDLDQDVLSALSEVEQLSKMVSEAKLRADEAKQSAEDILLKTNATKEKMDKSNEDL
RNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVI
LQQSAADIARAEMLLEEAKKASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDI
QGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVK
QSAEDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLL
KDLERKYEDNQKYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL
Download sequence
Identical sequences A0A096N0Q7
ENSPANP00000005845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]