SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006136 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006136
Domain Number 1 Region: 182-311
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-32
Family Pleckstrin-homology domain (PH domain) 0.0004
Further Details:      
 
Domain Number 2 Region: 346-454
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-24
Family SH2 domain 0.0000339
Further Details:      
 
Domain Number 3 Region: 24-84
Classification Level Classification E-value
Superfamily Phenylalanine zipper 7.06e-22
Family Adapter protein APS, dimerisation domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006136   Gene: ENSPANG00000009638   Transcript: ENSPANT00000023203
Sequence length 570
Comment pep:known_by_projection chromosome:PapAnu2.0:11:110566420:110608236:1 gene:ENSPANG00000009638 transcript:ENSPANT00000023203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGPALQPSSASSPPSASPVPAPRGWSEFCELHAVAAARELARQYWLFAREHPQHAPLRA
ELVSLQFTDLFQRYFCREVRDGRAPGRDYRDTGRGPPAKAEASPEPGPGLAAPGLPKARS
SEELAPPRPPGPCSFQHFRRSLRHIFRRRSAGELPAAHTAAALGTPGEAAETPARPGLAK
KLLPWSLAREPPPEALKEAALRYSLADEASMDSGARWQRGRLALRRAPGSDGPDGPDRVL
ELFDPPKSSRPKLQAACSSIQEVRRCTRLEMPDNLYTFVLKVKDRTDIIFEVGDEQQLNS
WMAELRECTGRGLESTEAEMHIPSALEPSTSSSPRGSTDSLNQGASPGGLLDPACQKTDH
FLSCYPWFHGPISRVKAAQLVQLQGPDAHGVFLVRQSETRRGEYVLTFNFQGIAKHLRLS
LTERGQCRVQHLHFPSVVDMLHHFQRSPIPLECGAACDVRLSSYVVVVSQPPGSCNTVLF
PFSLPHWDSELGLPHLSSSGCPRGLSPEGLPGRSSPPEQIFHLVPSPEELANSLRHLEPE
PVNRARDSDYEMDSSSRSHLRAIDNQYTPL
Download sequence
Identical sequences A0A096N1G4
ENSPANP00000006136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]