SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006147 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006147
Domain Number 1 Region: 347-416,895-1064
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-40
Family Protein kinases, catalytic subunit 0.00026
Further Details:      
 
Domain Number 2 Region: 10-126
Classification Level Classification E-value
Superfamily PX domain 1.57e-22
Family PX domain 0.0028
Further Details:      
 
Domain Number 3 Region: 235-334
Classification Level Classification E-value
Superfamily MIT domain 9.68e-22
Family MIT domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006147   Gene: ENSPANG00000017815   Transcript: ENSPANT00000006914
Sequence length 1066
Comment pep:known_by_projection scaffold:PapAnu2.0:JH684903.1:1914993:2125216:1 gene:ENSPANG00000017815 transcript:ENSPANT00000006914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSYRERSADLARFYTVTEPQRHPRGYTVYKVTARVVSRRNPEDVQEIIVWKRYSDFKKL
HKELWQIHKNLFRHSELFPPFAKGIVFGRFDETVIEERRQCAEDLLQFSANIPALYNSKQ
LEDFFKGGIINDSSELIGPAEAHSDSLIDTFPECSTEGFSSDSDLISLTVDVDSLAELDD
GMASNQNSPIRTFGLNLSSDSSALGAVASDSEQSKTEEERESRSLFPGSLKPRLGKRDYL
EKAGELIKLALKKEEEDDYEAASDFYRKGVDLLLEGVQVGESSPTRREAVKRRTAEYLMR
AESISGLYGKFQLDDVSQPPGSLSSRPPWNLRSPAEELKAFRVLGVIDKVLLVMDTRTEQ
TFILKGLRKSSEYSRNRKTIIPRCVPNMVCLHKYIISEESVFLVLQHAEGGKLWSYISKF
LNRSPEESFDIKEVKKSTLAKVHLQQPTSSPQDSSSFESRGSDGGSVLRALPLKSSLTPS
SQDDSNQEDDGQDSSPKWPDSGSSSEEECTTSYLTLCNEYGQEKIEPGSLNEEPFMKTEG
NGVDTKAIQSFPTHLADDSDSPSTQLRAHELKFFPNDDPEAVSSPRTSDSLSRSKNSPME
FFRIDSKDSASELLGLDFGEKLYSLKSEPLKPFFTLPDGDSASRSFNTSESKIEFKAQDT
ISRGSDDSVPVISFKDAAFDDVSGTDEGRPDLLVNLPGELEPREAAAMGPTKFTQTNIGI
IENKLLEAPDVLCLRLSTEQCQAHEEKGMEELSDPSGPKSRRMTEKHYAQDDPRMLFVAA
VDHSSSGDMSLLPSSDPRFQGLGVVESAVTANNTEESLFHICSPLSGANEYIASTDTLKT
EEVLLFTDQTDDLAKEEPTSLFQRDSETKGESGLALEGDKEIHQIFEDLDKKLALTSRFY
IPEGCIQRWAAEMVVALDALHREGIVCRDLNPNNILLNDRGHIQLTYFSRWSEVEDSCDS
DAIERMYCAPEVGAITEETEACDWWSLGAVLFELLTGKTLVECHPAGINTHTTLNMPECV
SEEARSLIQQLLQFNPLERLGAGVAGVEDIKSHPFFTPVDWAELMR
Download sequence
Identical sequences ENSPANP00000006147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]