SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006353 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006353
Domain Number 1 Region: 270-462
Classification Level Classification E-value
Superfamily Kelch motif 9.29e-57
Family Kelch motif 0.00000734
Further Details:      
 
Domain Number 2 Region: 425-559
Classification Level Classification E-value
Superfamily Kelch motif 9.55e-37
Family Kelch motif 0.00029
Further Details:      
 
Domain Number 3 Region: 14-133
Classification Level Classification E-value
Superfamily POZ domain 1.65e-35
Family BTB/POZ domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006353   Gene: ENSPANG00000019810   Transcript: ENSPANT00000017088
Sequence length 574
Comment pep:known_by_projection chromosome:PapAnu2.0:2:88047117:88105901:-1 gene:ENSPANG00000019810 transcript:ENSPANT00000017088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEDGAEELEDLVHFSVSELPSRGYGVMEEIRRQGKLCDVTLKIGDHKFSAHRIVLAASI
PYFHAMFTNDMMECKQDEIVMQGMDPSALEALINFAYNGNLAIDQQNVQSLLMGASFLQL
QSIKDACCTFLRERLHPKNCLGVRQFAETMMCAVLYDAANSFIHQHFVEVSMSEEFLALP
LEDVLELVSRDELNVKSEEQVFEAALAWVRYDREQRGPYLPELLSNIRLPLCRPQFLSDR
VQQDDLVRCCHKCRDLVDEAKDYHLMPERRPHLPAFRTRPRCCTSIAGLIYAVGGLNSAG
DSLNVVEVFDPIANHWERCRPMTTARSRVGVAVVNGLLYAIGGYDGQLRLSTVEAYNPET
DTWTRVGSMNSKRSAMGTVVLDGQIYVCGGYDGNSSLSSVETYSPETDKWTVVTPMSSNR
SAAGVTVFEGRIYVSGGHDGLQIFSSVEHYNHHTATWHPAAGMLNKRCRHGAASLGSKMF
VCGGYDGSGFLSIAEMYSSVADQWCLIVPMHTRRSRVSLVASCGRLYAVGGYDGQSNLSS
VEMYDPETDCWTFMAPMACHEGGVGVGCIPLLTI
Download sequence
Identical sequences ENSPANP00000006353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]