SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006656 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006656
Domain Number 1 Region: 121-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000662
Family Cripto EGF-like domain-like 0.0049
Further Details:      
 
Domain Number 2 Region: 87-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000154
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006656   Gene: ENSPANG00000021925   Transcript: ENSPANT00000020209
Sequence length 234
Comment pep:novel chromosome:PapAnu2.0:13:127592252:127598749:1 gene:ENSPANG00000021925 transcript:ENSPANT00000020209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTWRHHVRFLFTVSLALQIINLGNSYQREKHNGRREEVTKVATQKHQQSPLNWTSSHSGE
VTGSAQGWGPEEPLPYSRAFREGASARPRCCRNGGTCVLGSFCVCPAHFTGRYCEHDQRR
SECGALEHGAWTLRGCHLCRCVFGTLHCLPLQTPGSCDPKDFLASHAPGRGAGGAPSLLL
LLPCALLHRLLRLDAPAHPRSLVPSVLQRERRPLRKAGTWASPFIFTVVNNRCV
Download sequence
Identical sequences A0A096N2W1
ENSPANP00000006656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]