SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006798 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006798
Domain Number 1 Region: 502-799
Classification Level Classification E-value
Superfamily L domain-like 3.3e-44
Family Ngr ectodomain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 81-450
Classification Level Classification E-value
Superfamily L domain-like 8.84e-42
Family Ngr ectodomain-like 0.0026
Further Details:      
 
Domain Number 3 Region: 888-1040
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.75e-36
Family Toll/Interleukin receptor TIR domain 0.0000976
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006798   Gene: ENSPANG00000003159   Transcript: ENSPANT00000024514
Sequence length 1058
Comment pep:known_by_projection chromosome:PapAnu2.0:X:10204085:10216216:1 gene:ENSPANG00000003159 transcript:ENSPANT00000024514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKESSLQNSSCSLGKESKKENMFLQSSMLTCLFLLIPGSCELCPEENFSRSYPCQEKKRN
DFVIAECSNRRLREVPQTVGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNVQR
QNGNPGMQSNGLNITDGAFLNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNIT
KEGISRLINLKYLYLAWNCYFNKVCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPS
SLRKLFLSNTQIKYIGEEDFKGLINLTLLDLSGNCPRCFNAPFPCVPCDGGASINIDRFA
FQNLTQLQYLNLSSTSLRKINAAWFKNMPHLKVLDLEFNYLVGEIASGEFLTMLPRLEIL
DLSFNYIKGSYPQHINISKNFSKLLSLRALHLRGYVFQELRKDDFQPLMQLPNLSTINLG
INFIKQIDFNLFQNFPNLEIIYLSENRISPLVKDTRQSYANSSSFQRHILKRRSTDFEFD
PHSNFYHFTRPLIKPQCAAYGKALDLSLNNIFFIGPNQFENLPDIACLNLSANSNAQVLS
GTEFSAIPHVKYLDLTNNRLDFDNASALTELSDLEVLDLSYNSHYFRIAGVTHHLEFIQN
FTNLKVLNLSHNNIYTLTDKYNLESKSLVELVFSGNRLDILWNDDDNRYISIFKGLTNLT
KLDLSLNKLKHIPNEAFLNLPASLTELHINDNMLKFFNWTLLQQFPHLQLLDLRGNKLFF
LTDSLSDFTSSLQTLLLSHNRISHLPSGFLSEVSSLMRLDLSSNLLKTINKSALETKTTT
NLCFLELHGNPFECTCDIGDFRRWMDEHLNVTIPRLVDVICASPGDQRGKSIVSLELTTC
VSDVTAVILFFFTFFITTMVMLTALAHHLFYWDVWFIYNVCLAKVKGYRSLSTSQTFYDA
YISYDTKDASVTDWVINELRYHLEESQDKNVLLCLEERDWDPGLAIIDNLMQSINQSKKT
VFVLTKKYAKSWNFKTAFYLALQRLMDENMDVIIFILLEPVLQHSQYLRLRQRICKSSIL
QWPDNPKAEGLFWQTLRNVVLTENDSRYNNMYVDSIKQ
Download sequence
Identical sequences ENSPANP00000006798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]