SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006884 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006884
Domain Number 1 Region: 3867-4059
Classification Level Classification E-value
Superfamily Fibronectin type III 5.14e-37
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 2 Region: 4522-4728
Classification Level Classification E-value
Superfamily Fibronectin type III 2.99e-35
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 3 Region: 4261-4436
Classification Level Classification E-value
Superfamily Fibronectin type III 1.36e-33
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 4 Region: 4727-4925
Classification Level Classification E-value
Superfamily Fibronectin type III 3.53e-32
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 5 Region: 2525-2668
Classification Level Classification E-value
Superfamily Fibronectin type III 8.93e-32
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 6 Region: 1048-1237
Classification Level Classification E-value
Superfamily Fibronectin type III 6.82e-31
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 7 Region: 1513-1683
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.32e-31
Family Laminin G-like module 0.0054
Further Details:      
 
Domain Number 8 Region: 2136-2323
Classification Level Classification E-value
Superfamily Fibronectin type III 7.02e-29
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 9 Region: 1701-1889
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-28
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 10 Region: 2323-2527
Classification Level Classification E-value
Superfamily Fibronectin type III 4.53e-28
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 11 Region: 3582-3712
Classification Level Classification E-value
Superfamily Fibronectin type III 1.22e-27
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 12 Region: 2813-2999
Classification Level Classification E-value
Superfamily Fibronectin type III 1.75e-27
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 13 Region: 1237-1282,1313-1413
Classification Level Classification E-value
Superfamily Fibronectin type III 1.52e-25
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 14 Region: 3681-3860
Classification Level Classification E-value
Superfamily Fibronectin type III 9.96e-25
Family Fibronectin type III 0.0065
Further Details:      
 
Domain Number 15 Region: 1981-2137
Classification Level Classification E-value
Superfamily Fibronectin type III 3.26e-24
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 16 Region: 3449-3580
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-23
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 17 Region: 3014-3144
Classification Level Classification E-value
Superfamily Fibronectin type III 3.6e-22
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 18 Region: 2682-2815
Classification Level Classification E-value
Superfamily Fibronectin type III 1.37e-20
Family Fibronectin type III 0.0043
Further Details:      
 
Domain Number 19 Region: 4016-4148
Classification Level Classification E-value
Superfamily Fibronectin type III 3.24e-20
Family Fibronectin type III 0.0047
Further Details:      
 
Domain Number 20 Region: 118-288
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-17
Family Pentraxin (pentaxin) 0.083
Further Details:      
 
Domain Number 21 Region: 4142-4257
Classification Level Classification E-value
Superfamily Fibronectin type III 6.49e-17
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 22 Region: 1455-1521,1898-1949
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000164
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 23 Region: 4427-4531
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000546
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 24 Region: 636-686
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000921
Family Laminin-type module 0.0066
Further Details:      
 
Domain Number 25 Region: 841-891
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000117
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 26 Region: 789-838
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000103
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 27 Region: 894-936
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000195
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 28 Region: 689-739
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000268
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 29 Region: 570-622
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000145
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 30 Region: 996-1044
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 31 Region: 945-989
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Laminin-type module 0.0097
Further Details:      
 
Domain Number 32 Region: 742-783
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000642
Family Laminin-type module 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000006884
Domain Number - Region: 513-567
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000243
Family Laminin-type module 0.046
Further Details:      
 
Domain Number - Region: 334-410
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00879
Family beta-mannanase CBM 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006884   Gene: ENSPANG00000010480   Transcript: ENSPANT00000015123
Sequence length 5195
Comment pep:known_by_projection chromosome:PapAnu2.0:1:148710946:149494148:1 gene:ENSPANG00000010480 transcript:ENSPANT00000015123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSMGSGFLFQVIDMLIFAYFASISLADSRGLFPRLENVGAFKNVSIVPTQAVCGLPDRS
TFCHSSAAAESIQFCSQRFCIQDCPYRSSHPTYTALFSAGLSCITPDKNDLHPNSHSNST
SFVFGNHKNCFSSPPSPRLMASFTLAVWLKPEQQGVMCVIEKAVDGQIVFKLTISEKETM
FYYRTVNGLQPPIKVMTLERILVKKWIHLSVQVHQTKISFFINGVEKDHTPFDARTLSGS
ITDFASGTVQIGQSLNGLEQFVGRMQDFRLYQVALTNREILEVFSGDLLRLHAQSHCRCP
GSHPRVHPLAQRYCIPNDAGDTADNRVSRLNPEAHPLSFVNDNDVGTSWVSNVFTNVTQL
NQGVTISVDLENGQYQVFYIIIQFFSPQPTEIRIQRKKENSLDWEDWQYFARNCGAFGMK
NNGDLEKPDSVNCLQLSNFTPYSRGNVTFSILTPGPNYRPGYNDFYNTPSLQEFVKATQI
RFHFHGQYYTTETAVNFRHRYYAVDEITISGRCQCHGHADNCDTTSQPYRCLCSQESFTE
GLHCDRCLPLYNDKPFRQGDQVHAFNCKRCQCNSHSKSCYYNVSVDPFPFEHFRGGGGVC
NDCEHNTTGRNCELCKDYFFRQVGADPSAIDVCKPCDCDKVGARNGSILCDQIGGQCNCK
RHVSGRQCNQCQNGFYNLQELDPDGCSPCNCNTSGTVDGDITCHQNSGQCKCKANVIGLR
CDRCNFGFKFLRSFNDDGCEPCQCNLHGSVNKFCNPLSGQCECKEAKGLQCDTCRENFYG
LDVTNCKACDCDTAGSLPGTVCNAKTGQCICKPNVEGRQCNKCLEGHFYLRQNNSFLCLP
CNCDKAGTINGSLLCDKSTGQCPCKLGVTGLRCNQCEPHRYNLTIDNFQGCQMCECDSLG
TLPGTICDPISGQCLCVPNRQGRRCNQCQPGFYISPGSANGCLPCSCHTAGSVHHICNSL
TGQCVCQDASIAGQRCDQCKDRYFGFDPQTGRCQPCNCHLSGALNETCHLVTGQCFCKQF
VTGSKCDACVPSASHLDVNNLLGCSKTPFQQPPPRGQVQSSSAINLSWSPPDSPNAHWLT
YSLLRDGFEIYTTEDQYPYSVQYFLDTDLLPYTKYSYYIETTNVHGSTRSVTVTFRTKPG
VPDGNLTLSYIIPVGSDSVTLTWTTLSNQSGPIEKYILSCVPLAGGQPCVSYEGHATSAT
IWNLVPFAKYYFSVQACTSGGCLHSLPITVTTAQAPPQRLSPPKVQKISSTELHVEWSPP
MELNGIIIRYELYMRRLRSTKETTSEESRVFQSSGWLSPQSFAESANENALKPPQTMTTI
TGLEPYTKYEFRVLAVNMAGSVSSAWVSERTGESAPVFMIPPSVVPLSSYSLNISWEKPA
DNVTRGKVVGYDINMISEQSLQQSIPVVFSQLLYTAKSQELSYTVEGLKPYRIYEFTITV
CNSVGCVTSASGAGQTLAAAPAQLRPPLVKGINSTTIHLRWFPPEELNGPSPIYQLERRE
SSLPALMTTMMKGIRFTGNGYCKFPSSTHPVNTDFTGIKASFRTKVPEGLIVFAASPGNQ
EEYFALQLKKGRLYFLFDPQGSPVEVTTTNDHGKQYSDGKWHEIIAIRHQAFGQITLDGI
YTGSSAILNGSTVIGENTGVFLGGLPQSYTILRKDSEIIQKGFVGCLKDVHFMKNYNPSA
IWEPLDWQNSEEQINVYNSWEGCPASLNEGAQFLGAGFLELHPYMFHGGMNFEISFKFRT
DQLNGLLLFVYNKDGPDFLAMELKSGILSFRLNTSLAFTQVDLLLGLSYCNGKWNKVIIK
KEGSFISTSMNGLMKHASESGAQPLVVNSPVYVGGIPQELLNSYQHLCLEQGFGGCMKDV
KFTRGAVVNLASVSSGAVRVNLDGCLSTDSAVNCRGNDSILVYQGKEQSVYESGLQPFTE
YLYRVRASHEGGSVYSDWSRGRTTGAAPQSVPTPSRVRSLNGYSIEVTWDEPVVTGVIEK
YILKAYSEDNTRPPYMPSASAEFVNTSTLTGILTGLLPFKNYAVTLTACTLAGCAESSHA
LNISTPQEAPQEVQPPAAKSLPKSLLLSWNPPKKANGIITQYSLYMDGRLIYSGSEENYT
VTDLAVFTPHQFLLSACTHVGCTNSSWVLLYTAQLPPEHVDSPVLTVLDSRTIHVQWKQP
RKISGILERYILYVSNHTDDFTIWSVIYNSTELFQDHMLQYLVPGNKYLIKLGACTGGGC
TVSEASEALTDEDIPEGVPAPEVHSYSPDSFNVSWTEPEYPNGVIMSYGLYLDGVLIHNS
SELSCRAYGFAPWSLHSFRVQACTAKGCALGPLVENRTLEAPPEGTVNVFVKTQGSRKAH
VRWEAPFRPNGRLTYSVLFTGIFYVDPVGNNYTLLNVTKVMYSGEETNLWVLMDGLVPFT
NYTVQVNISNSQGSLITDPITIAMPPGAPDGVLPPRLSSATPTSLQVVWSTPARNNAPGS
PRYQLQMRSGDSTHEFLELFSNPSASLSYEVSDLQPYTEYMFRLVASNGFGSAHSSWIPF
MTAEDKPGPVVPPILLDVKSRMMLVTWQHPRKSNGVITHYNIYLHGRLYLRTPGNVTNCT
VTHLHPYTAYKFQVEACTSKGCSLSPESQTVWTLPGAPEGIPSPELFSDTPTSVIISWQP
PTHPNGLVENFTIERRVKGKEEVTTLVTLPRSHSMRFIDKTSALSPWTKYEYRILMSTLH
GGTNSSAWVEVTTRPSRPAGVQPPVVTVLGPDAAQVTWKPPLIQNGDLLSYEIRMPDPHI
TITNVTSAVLSQKVTHLIPFTNYSVTIVACSGGNGYLGGCTESLPTYVTTHPTVPQNVGP
LSVIPLSESYVVISWQPPSKPNGPNLRYELLRRKIQQPLASNPPEDLNRWHNIYSGTQWF
YEDKGLSRFTTYEYMLFVHNSVGFTPSQEVTVTTLAGLPERGASLTASVLNHTAIDVRWA
KPTIQDLQGEVEYYTLVWSSATSNDSLKILPDVNSHVIGHLKPNTEYWIFISVFNGVHSI
NSAGLHATTCDGEPQGMLPPEVVIINSTAVRVIWTSPSNPNGVVTEYSIYVNNKLYKTGM
NMPGSFILRDLSPFTVYDIQVEVCTIYACVKSNGTQITTVEDTPSDIPTPTIRGITSRSL
QIDWMPPRKPNGIILGYDLLWKTWYPCPKTQKVVQDQSDELCKAVCQKPEYICGHICYSP
EARVCCNGVLYNPKPGHLCCEEKYIPFVLNSTGVCCGGRIQEAQPNHQCCSGYYARILPG
EVCCPDEQHNRVSVGIGDSCCGRMPYSTSGNQICCAGRLHDGHGQQCCGRQIVSNDLECC
GGEEGVAYNRLPGMFCCGQDYVNMSDTICCSASSGESKAHVKKNDPVPVKCCETELIPKS
QKCCNGVGYNPLKYVCSDKISTGMMMKETKDCRTLCPASMEATAHCGKCDFNFTSHICTV
IRGSHNSTGKASVEEMCSSAEETIHTGSVNTYSYTVVNLKPYMTYEYRISAWNSYGRGLS
QAVRARTKEDVPQGVSPPTWTKIDNLEDTIVVNWRKPIQSNGPVIYYILLRNGIERFRGT
SLSFSDKEGIQPFQEYSYQLKACTVAGCATSSKVVAATTQGVPESILPPRITAQSAEALH
LSWSAPEKPNGVIKEYQISQVGKGLIHTDTTDRRQHTVTGLQPYTNYSFTLTACTSAGCT
SSEPFLGQTLQAAPEGVWVTPRHIIINSTTVELYWSLPEKPNGLISQYQLSRNGNLLFLG
GSEEQNFTDKNLEPNSRYTYKLEVKTGGGSSTSDDYIVQTPMSTPEEIHPPYNITVIGPY
SIFVAWTPPGILIPKIPVEYNVLLNDGSVIPLAFSVGHHQSTLLENLAPFTQYEIRIQAC
QNGSCGVSSRMFVKTPEAAPMDLNSPALKALGSACIQIKWMPPEKPNGIIINYFIYRRPA
GIEEESLLFIWSEGALEFTDEGDTLRPFTLYEYRVRACNSKGSVESLWSLTRTLEAPPQD
FPAPWAQVTSAHSVLLNWTKPESPNGIISHYCVVYQEKPNDPTFNSPTVHAFTVMGTSHQ
AHLFGLEPFTTYLIGVVAANHAGEILSPWTLIQTLESSPSGLRNFIVEQKENGRALLLQW
SEPMRTNGVIKTYNIFSDGLLEYSGLNRQFLFRRLDPFTLYTLTLQACTRAGCAHSASQP
LWTDEAPPDSQLAPTVHSVKSTSVELNWSEPVNPNGKIIRYEVIRRCFEGKAWGNQTVQA
DEKIVFTEYNTEKNTFLYNDTGLQPWTQCEYKIYTWNSAGHTCSPWNVVRTLQAPPEGLS
PPVISYVSMNPQKLLISWIPPEQSNGIIQSYRLQRNETLYPFSFDAVTFNYTDEELLPFS
TYSYALQACTSGGCSTSKSTSITTLEAAPSGVSPPDLRTVSATQINVCWSPPTVKNGKIT
KYLVRYDNEESLAGQGLCLLVSHLQPYTQYNFSLVACTNGGCTASVSKSAWTMEALPENM
DSPTLQVTGSESIEITWKPPRNPNGQIRSYELRRDGIIVYTGLETRYHDFTLTPGVEYGY
TVTANNSQGGILSPLAKDRTNPSAPSGMEPPRLQARGPQEILVNWDPPVKTNGDIINYTL
FIRELFQRETKIIHINTTHNSFGTQSYIVKQLKPFHRYEIRIQACTTLGCASSDWTFIQT
PEIAPLMQPPPHLEVQMAPGGFQPIVSLLWTGPLQPNGKVLYYELYRRQIAIQPGKSSPV
LIYNGSSTSFIDSELLPFTEYEYQVWAVNSAGKAPSSWTWCRTGPAPPEGVRAPTFHAVS
STQAVVNISAPKKPNGIVSLYRLFSSSAHGAETVLSEGMATQQTLHGLQAFTNYSIGVEA
CTCFNCCSKGPTAELRTHPAPPSGLSSPHIETLASRTASFQWSPPMFPNGVIHSYELQLH
VACPPDSALPCTPSQIETKYMGLGQKASLGGLQPYTTYKLRVVAHNEVGSTASEWINFTT
QKELPQYRAPFSVDSNLSVVCVNWSGTFFLNGPLKEYVLTDGGRRVYSGFDTTLYIPRTA
DKTFFFQVICTTDEGSVKTPLIQYDTSTGLGLVLTTPGEKKGSQSKSTEFYSELWFIVLM
AILGLILLAIFLSLILQRKIHKEPYIRERPPLVPLQKRMSPLNVYPPGENHMGLADTKIP
RSGTPVSIRSNRSACVLRIPSQSQTGLTYSQGSLHRSVSQLMDVQDKKVLMDDSLWEAIM
GHNSGLYVDEEDLMNAIKGFSSVTKEHTTFTDTHL
Download sequence
Identical sequences ENSPANP00000006884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]