SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007059 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007059
Domain Number 1 Region: 342-402
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.76e-17
Family Erythroid transcription factor GATA-1 0.00014
Further Details:      
 
Domain Number 2 Region: 287-340
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.5e-16
Family Erythroid transcription factor GATA-1 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007059   Gene: ENSPANG00000005346   Transcript: ENSPANT00000000692
Sequence length 480
Comment pep:known_by_projection chromosome:PapAnu2.0:11:84617882:84627415:1 gene:ENSPANG00000005346 transcript:ENSPANT00000000692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYY
ANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSP
FSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGNGSSVASLTPTAAHSGSHLFGFPPTPPKE
VSPDPSTTGAASPGSSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQP
ATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGA
TATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLW
RRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKC
MQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG
Download sequence
Identical sequences A0A096N3W4
ENSPANP00000007059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]