SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007072 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007072
Domain Number 1 Region: 41-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000195
Family EGF-type module 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007072   Gene: ENSPANG00000010483   Transcript: ENSPANT00000001573
Sequence length 159
Comment pep:known_by_projection chromosome:PapAnu2.0:13:69399283:69509089:-1 gene:ENSPANG00000010483 transcript:ENSPANT00000001573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPSAGQLALFALGIVLAACQALENSTSLLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCR
FLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLI
HCCQVRKHCEWCRALICRHEKPSTLLKGRTACCHSETVV
Download sequence
Identical sequences A0A096N3X7
ENSPANP00000007072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]