SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007331 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007331
Domain Number 1 Region: 396-663
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-79
Family Protein kinases, catalytic subunit 0.000000014
Further Details:      
 
Domain Number 2 Region: 5-145
Classification Level Classification E-value
Superfamily PH domain-like 2.26e-43
Family Pleckstrin-homology domain (PH domain) 0.0000501
Further Details:      
 
Domain Number 3 Region: 291-437
Classification Level Classification E-value
Superfamily SH2 domain 5.39e-33
Family SH2 domain 0.0000448
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007331   Gene: ENSPANG00000011362   Transcript: ENSPANT00000002407
Sequence length 674
Comment pep:known_by_projection chromosome:PapAnu2.0:X:12824001:12881385:1 gene:ENSPANG00000011362 transcript:ENSPANT00000002407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIEIKKI
RCVEKVNLEEQTPVERQYPFQIVYKDGLLYVYASNEESRSQWLKALQKEIRGNPHLLIKY
HSGFFVDGKFLCCQQSCKAAPGCTLWEAYANLHIAVNEEKYRVPTFPDRVLKIPRAVPVL
KMDAPSSSTTLAQYDNESMKNYGFQPPSSSTTVAQYDSNSKKIYGSQPNFNMQYIPKEDY
PDWGQERKLKSSSSSEDVASSNQKERNVNHTTTKISWGFPESSSSEEEANLDDYDWFAGN
ISRSQSEQLLRQKGKEGAFMVRNSSQVGMYTVSLFSKAVNDKKGTVKHYHVHTNAENKLY
LAENYCFDSIPKLIHYHQHNSAGMITRLRHPVSTKANKVPDSVSLGNGIWELKREEITLL
KELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMTKLSHPKLVKFYGVCS
KEYPIYIVTEYISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAAR
NCLVDSDLCVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGI
LMWEVFSGKQPYDLYDNSQVVLKVSQGHRLYRPHLASDTIYQIMYSCWHELPEKRPTFQQ
LLSSIEPLREKDKP
Download sequence
Identical sequences ENSPANP00000007331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]