SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007418 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007418
Domain Number 1 Region: 61-247
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-38
Family Laminin G-like module 0.007
Further Details:      
 
Domain Number 2 Region: 246-431
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.65e-38
Family Laminin G-like module 0.0055
Further Details:      
 
Domain Number 3 Region: 696-872
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.11e-34
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 4 Region: 880-1084
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-30
Family Laminin G-like module 0.0067
Further Details:      
 
Domain Number 5 Region: 490-547
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000000123
Family Fibrinogen C-terminal domain-like 0.0053
Further Details:      
 
Domain Number 6 Region: 461-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000343
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007418   Gene: ENSPANG00000010545   Transcript: ENSPANT00000024534
Sequence length 1219
Comment pep:known_by_projection chromosome:PapAnu2.0:13:121494734:122070421:1 gene:ENSPANG00000010545 transcript:ENSPANT00000024534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQIQRKPELRTLQRHRHRPRRNLNYSPPLTPPSTLNWTFAGNMNADSVVHHKLLHSVRA
RFVRFVPLEWNPSGKIGMRVEVYGCSYKSDVADFDGRSSLLYRFNQKLMSTLKDVISLKF
KSMQGDGVLFHGEGQRGDHITLELQKGRLSLHLNLDDSKARLSSSLPSATLGSLLDDQHW
HSVLIERVGKQVNFTVDKHTQHFRTKGETDALDIDYELSFGGIPVPGKPGTFLKKNFHGC
IENLYYNGVNIIDLAKRRKHQIYTVGNVTFSCSEPQIVPITFVNSSGSYLLLPGTPQIDG
LSVSFQFRTWNKDGLLLSTELSEGSGTLLLSLESGILRLVIQKMTERVAEILTGSNLNDG
LWHSVNINARRNRITLTLDNEAAPPAPDSTWVQIYSGNSYYFGGCPDNLTDSQCLNPIKA
FQGCMRLIFIDNQPKDLISVQQGSLGNFSDLHIDLCSIKDSRCLPNYCEHGGSCSQSWTT
FYCNCSDTSYTGATCHNSIYEQSCEVYRHQGNTAGFFYIDSDGSGPLGPLQVYCNITEDK
IWTSVQHNNTELTRVRGANAEKPYAMALDYGGSMEQLEAVIDGSEHCEQEVAYHCRRSRL
LNTPDGTPFTWWIGRSNERHPYWGGSPPGVQQCECGLDESCLDIQHFCNCDADKDEWTND
TGFLSFKDHLPVTQIVITDTDRSNSEAAWRIGPLRCYGDRRFWNAVSFYTEASYLHFPTF
HAEFSADISFFFKTTALSGVFLENLGIKDFIRLEVSAPSEITFAIDVGNGPVELVVQSPS
LLNDNQWHYVRAERNLKETSLQVDNLPRSTRETSEEGHFRLQLNSQLFVGGTSSRQKGFL
GCIRSLHLNGQKLDLEERAKVTSGVRPGCPGHCSSYGSICHNGGKCVEKHNGYLCDCTNS
PYEGPFCKKEVSAVFEAGTSVTYMFQEPYPVTKNISLSSSAIYTDSAPSKENIAFSFVTA
QTPSLLLFVNSSSQDFLAVLLCKNGSLQVRYHLNKEETHVFTIDADNFANRRMHHLKINR
EGRELTIQMDHQLRLSYNFSPEVEFRVIRSLTLGKVTENLSLDSEVAKANALGFAGCLSS
VQYNHIAPLKAALRHATVAPVTVHGTLMESSCDFMVDSDVDAVTTVHSSSDPFGKTDERE
PLTNAVRSDSAVIGGVIAVVIFIIFCIIGIMTRFLYQHKQSHRTNQMKEKEYPENLDSSF
RNDIDLQNTVSECKREYFI
Download sequence
Identical sequences ENSPANP00000007418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]