SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008216 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008216
Domain Number 1 Region: 239-349
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-24
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 62-173
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-21
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 3 Region: 356-421
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000783
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 415-477
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000375
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 5 Region: 483-542
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000642
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 6 Region: 3-64
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000181
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 7 Region: 178-242
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000499
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008216   Gene: ENSPANG00000018714   Transcript: ENSPANT00000010305
Sequence length 635
Comment pep:known_by_projection chromosome:PapAnu2.0:10:66856650:66948724:1 gene:ENSPANG00000018714 transcript:ENSPANT00000010305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSCNFPRRPDSGDVTVMDLHSGGVAHFHCHLGYELQGAKMLTCINASKPHWSSQEPICS
APCGGTVHNATIGRVLSPSYPGNTNGSQFCVWTIEAPEGQKLHLHFERLSLHDKDRMTVH
SGQTNKSALLYDSLQTESVPFEGLLSEGDTIRIEFTSDQARAASTFNIRFEAFEKGHCYE
PYIQNGNFTTSDPTYNIGTIVEFTCDPGHSLEQGPAIIECINVRDPYWNDTEPLCRAMCG
GELSAVAGVVLSPNWPEPYVEGEDCIWKIHVGEEKRIFLDIQFLNLSNSDILTIYDGDEV
MPHILGQYLGNSGPQKLYSSTPDLTIQFHSDPAGLIFGKGQGFIMNYIEVSRNDSCSDLP
EIQNGWKTTSHTELVRGARITYQCDPGYDIVGSDTLTCQWDLSWSSDPPFCEKIMYCTDP
GEVDHSTRLISDPVLLVGTTIQYTCNPGFVLEGSSLLTCYSRETGTPIWTSRLPHCVSEE
SLACDNPGLPENGYQILYKRLYLPGESLTFMCYEGFELMGEVTIRCILGQPSHWNGPLPV
CKVNQDSFEHALEVAEAAAETSLEGGNMALAIFIPVLIISLLLGGAYIYITRCRYYSNLR
LPLMYSHPYSQITVETEFDNPIYETGETREYEVSI
Download sequence
Identical sequences ENSPANP00000008216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]