SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008274 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008274
Domain Number 1 Region: 474-766
Classification Level Classification E-value
Superfamily L domain-like 4.76e-49
Family Ngr ectodomain-like 0.026
Further Details:      
 
Domain Number 2 Region: 41-432
Classification Level Classification E-value
Superfamily L domain-like 9.86e-40
Family Internalin LRR domain 0.032
Further Details:      
 
Domain Number 3 Region: 863-1016
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.49e-26
Family Toll/Interleukin receptor TIR domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008274   Gene: ENSPANG00000015420   Transcript: ENSPANT00000001587
Sequence length 1031
Comment pep:novel chromosome:PapAnu2.0:2:83063214:83066309:1 gene:ENSPANG00000015420 transcript:ENSPANT00000001587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFCCSALHPLSLLVQAMVLATTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSAAAP
RGNVTSLSLSSNRIHHLHDSDFAHLPSLRRLNLKWNCPPVGLSPMHFPCHMTIEPSTFLA
VPTLEELNLSYNSITTVPALPKSLISLSLSHTNILVLDSDSLASLHSLRFLFMDGNCYYK
NPCRQELEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEHLLLSYNRIIKLAPEDLA
NLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLNA
SWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRQLNLSFNYHKRVSFAHLSLAPSFG
SLVALKELDMHGIFFRSLDETTLRPLARLPVLQTLRLQMNFISQAQLGIFRAFPGLRYVD
LSDNRISGASELTATMQEVDGGEKVWLQPGDLAPAPVDTPSSEDFRPNCSTLNFTLDLSR
NNLVTVRPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTSLQVLDLSHNKLDLYHEHSF
TELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSLR
ALDFSGNALGRMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPHTLDKLPKSLQVLRLR
DNYLAFFKWGNLIHLPKLEVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISFVDPGFF
SKAKELRELNLSANALKTVDPSWFGPLASALQILDVSANPLHCACGAAFIDFLLEVQAAV
PGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFTLSLLAVALGLGVPMLHHLCGW
DLWYCFHLCLAWLPWRGRQSGQGEDALPYDAFVVFDKTQSAVADWVYNELRGQLEERRGR
WALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLED
RKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHFY
NRNFCQGPTAE
Download sequence
Identical sequences ENSPANP00000008274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]