SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008284 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008284
Domain Number 1 Region: 5-129
Classification Level Classification E-value
Superfamily PH domain-like 1.89e-25
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008284   Gene: ENSPANG00000004006   Transcript: ENSPANT00000011346
Sequence length 587
Comment pep:known_by_projection chromosome:PapAnu2.0:X:142005383:142074227:-1 gene:ENSPANG00000004006 transcript:ENSPANT00000011346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGDAVCTGWLVKSPPERKLQRYAWRKRWFVLRRGRMSGNPDVLEYYRNKHSSKPIRVI
DLSECAVWKHVGPGFVRKEFQNNFVFIVKTTSRTFYLVAKTEQEMQVWVHSISQVCNLGH
LEDGTADSMESLSYTPSSLQPSSASSLHTAHAASSSLPRDDPNTNAVATEETRSESELLF
LPDYLVLSNCETGRLHHTSLPTRCDSWSNSDRSLEQASFDDVFVDCLQPLPSSHLVHPSC
HGNGAQEVPSSRPQPALIWSREINGPPRDHLSSSPLLESPLSSTIQVDKNQGSLPCGAKE
LDIMSNTPPPRPPKPSHLSERRQEEWSTHSGSKKPECTLVPRRISLSGLDSMRTWKADVE
GQSLRHRDKRLSLNLPCRFSPMYPTASASIEDSYVPMSPQAGASGLGPHCSPDDYIPMNS
GSISSQLPELPADLEPPPVNRDLKPQRKPRPPPLDLRNLSTIREHASLTRTRTVPCSRTS
FLSPERNGINSARFFANPVSREEEESYIEMEEHRTTSSLSSGALTWTKKFSLDYLALDFN
SASPAPMQQKLLLSEEQRVDYVQVDEQKTQALQSTKQEWTDERQSKV
Download sequence
Identical sequences A0A096N703
ENSPANP00000008284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]