SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008324 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008324
Domain Number 1 Region: 33-126
Classification Level Classification E-value
Superfamily Immunoglobulin 3.54e-20
Family I set domains 0.0065
Further Details:      
 
Domain Number 2 Region: 138-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000288
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008324   Gene: ENSPANG00000010408   Transcript: ENSPANT00000018091
Sequence length 522
Comment pep:known_by_projection chromosome:PapAnu2.0:6:133377584:133434467:-1 gene:ENSPANG00000010408 transcript:ENSPANT00000018091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESRRRGRGRGKKHREGRKREREPDPGEKATRPKLKKMKSQTGQVGEKQSLKCEAAAGN
PQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVR
GRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLE
KLPLRLYMPDPKQKHLGFELKEAEELYQKRVLTITGICVALLVVGIVCVVAYCKTKKQRK
QMHNHLRQNMCPAHQNRSLANGPSHPRLDPEEIQMADYISKNVPATDHVIRRETETTFSG
SHSCSPSHHCSTATPTSSHRHESHTWSLERSESLTSDSQSGIMLSSVGTSKCNSPACVEA
RARRAAAYNLEERRRATVPPYHDSVDSLRDSPHSERYVSALTTPARLSPVDFHYSLATQV
PTFEITSPNSAHAVSLPPAAPISYRLAEQQPLLRHPAPPGPGPGPGPGADMQRSYDSYYY
PAAGPGPRRGTCALGGSLGSLPASPFRIPEDDEYETTQECAP
Download sequence
Identical sequences ENSPANP00000008324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]