SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008361 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008361
Domain Number 1 Region: 122-508
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.63e-146
Family Myotubularin-like phosphatases 0.0000000245
Further Details:      
 
Domain Number 2 Region: 7-114
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000279
Family GRAM domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008361   Gene: ENSPANG00000010718   Transcript: ENSPANT00000017918
Sequence length 714
Comment pep:known_by_projection chromosome:PapAnu2.0:X:55732269:55844617:-1 gene:ENSPANG00000010718 transcript:ENSPANT00000017918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHITVPKVENVKLVDRYVSKKPANGILYLTATHLIYVEASGAARKETWIALHHIATVEK
LPITSLGCPLTLRCKNFRVAHFVLDSDLVCQEVYISLLKLSQPALPEDLYAFSYNPKSSK
EMRESGWKLIEAISDFGRMGIPNRYWTITDANRNYEICSTYPPEIVVPKSVTLGTVVGSS
KFRSKERVPVLSYLYKENNAAICRCSQPLSGFYTRCVDDELLLEAISQTNPGSQFMYVVD
TRPKLNAMANRAAGKGYENEDNYANIRFRFMGIENIHVMRNSLQKLLEVCELKTPTMSEF
LSGLESSGWLRHIKAIMDAGIFITKAVKVEKASVLVHCSDGWDRTAQVCSVASILLDPFY
RTFKGLMKMKILIEKEWISMGHKFSQRCGHLDGDSKEVSPIFTQFLDCIWQLMEQFPCAF
EFNENFLLEIHDHVFSCQFGNFLGNCQKDREDLSRVYEKTHSVWPFLVQRKPDFRNPLYK
GFTMYGVLNPSTVPYNIKFWCGMYNRFDKGLQAKQSILENLLEIKKQRAMLETDVHELEK
KLKARDEPPEEICTCTQLGNLLSQHLGSPLTNPLGFMGIDGDLNTLMENGTLSREGGLRA
QMDQVKTQCADLHHNHCEIVSSLRAINISGDVGISGGTGISEAMGISGDMSTFETMGFSE
DLGICGAMDISEATDISGNMGISEARGFSGDMGILGDTSISKASTKEADYSKHQ
Download sequence
Identical sequences ENSPANP00000008361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]