SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008381 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008381
Domain Number 1 Region: 46-138
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.69e-38
Family SCAN domain 0.0000688
Further Details:      
 
Domain Number 2 Region: 636-693
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 580-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 468-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.94e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 412-469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 524-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-23
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 7 Region: 678-730
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-21
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 8 Region: 374-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 9 Region: 217-278
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000575
Family KRAB domain (Kruppel-associated box) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008381   Gene: ENSPANG00000021914   Transcript: ENSPANT00000016750
Sequence length 747
Comment pep:known_by_projection chromosome:PapAnu2.0:2:90829873:90845665:-1 gene:ENSPANG00000021914 transcript:ENSPANT00000016750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSGRGNLGLIPRSTAFQKQEGRLTVKQEPANQSWGQGSSLQKNHPPVCEIFRLHFRQL
CYHEMSGPQEALSRLRELCHWWLMPEVHTKEQILELLVLEQFLSILPGELRTWVQLHHPE
SGEEAVAVVEDFQRHLSGPEEVSAPAQKQKMHLEDTAALGATKESPPTSPLSGGSAPGAH
QAPPYDPGTHHLPNGDFAQCASPVPTLPQVGNSGLRMVRPQDTVAYEDLCVDYTQKKWKC
PALSQRALQWNMMPENDRSMASLAGENMMKGSELTPKQEIFKGSESSNKTSGGLFGMVPG
GAETGDVCEDTSKELEGQTSDEEGSKLENDFLEITDEDKKKSTKDRYDKYKEVGEHLHLS
SSPAEHEGVLKGQKSYRCDQCGKTFNRSSHLIGHQRIHTGEKPYECNECGKTFRQTSQLI
VHLRTHTGEKPYECSECGKAYRHSSHLIQHQRLHNGEKPYKCNECAKAFTQSSRLIDHQR
THTGEKPYECNECGEAFIRSKSLVRHQVLHTGKKPYKCNECGRAFCSNRNLIDHQRTHTG
EKPYECSECGKAFSRSKCLIRHQSLHTGEKPYKCSECGKAFNQNSQLIEHERIHTGEKPF
ECSECGKAFGLSKCLIRHQRLHTGEKPYKCNECGKSFNQNSHLIIHQRIHTGEKPYECHE
CGKVFSYSSSLMVHQRTHTGEKPYKCNDCGKAFSDSSQLIVHQRVHTGEKPYECSECGKA
FSQRSTFNHHQRTHTGEKPSGLAWSVS
Download sequence
Identical sequences A0A096N786
ENSPANP00000008381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]