SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008480 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008480
Domain Number 1 Region: 280-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 476-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 3 Region: 198-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.46e-23
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 4 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.78e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 420-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-22
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-20
Family KRAB domain (Kruppel-associated box) 0.00058
Further Details:      
 
Domain Number 7 Region: 140-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.35e-20
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 8 Region: 522-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-17
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 9 Region: 96-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.61e-16
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 10 Region: 383-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000341
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 243-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000434
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008480   Gene: ENSPANG00000005118   Transcript: ENSPANT00000007871
Sequence length 576
Comment pep:known_by_projection chromosome:PapAnu2.0:19:11387193:11404900:1 gene:ENSPANG00000005118 transcript:ENSPANT00000007871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVAFEDVSVSFSQEEWALLAPSQKKLYRDVMQETFKNLASIGEKWEDQNVEEQHKNQG
RNLRSHMGERLCEGKESSQCAETVSPNLSVRKNTAGVKPYECTVCGKVFVRRSSLTRHMR
SHTGYELFEKPYKCKECGKAFSYLKSFQRHERSHTGEKPYKCKQCGKTFIYHQPFQTHER
THIGEKPYECKQCGKALSCPSSLRIHERIHTGEKPYECKKCGKAFSCPSSIRIHERTHTG
EKPYACKECGKAFISHTSVLTHMITHNGDRPYKCKECGKAFIFPSFLRVHERIHTGEKPY
KCKQCGKAFRCSTSIQIHERTHTGEKPYKCKECGKSFSARPAFRVHLRVHTGEKPYKCKE
CGKAFSRTSYFRIHERTHTGEKPYECKKCGKTFNYPLDLQIHERNHTGEKPYECKECAKA
FISLENFRRHMITHTGDGPYKCRDCGKAFIFPSALRTHERTHTGEKPYECKQCGKAFSCS
SYIQIHERTHTGEKPYECKECGKAFIYPTSFQGHMRMHTGEKPYKCKECGKAFSLHSSFQ
RHERIHSCEKPLECKQCGKAFSLSTSLQKHMRMHTR
Download sequence
Identical sequences A0A0A0MW39
ENSPANP00000008480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]