SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008740 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008740
Domain Number 1 Region: 107-273
Classification Level Classification E-value
Superfamily RUN domain-like 5.62e-51
Family RUN domain 0.000000245
Further Details:      
 
Domain Number 2 Region: 553-663
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000008740
Domain Number - Region: 428-595
Classification Level Classification E-value
Superfamily Tropomyosin 0.00183
Family Tropomyosin 0.0047
Further Details:      
 
Domain Number - Region: 298-361
Classification Level Classification E-value
Superfamily Prefoldin 0.00732
Family Prefoldin 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008740   Gene: ENSPANG00000019170   Transcript: ENSPANT00000011569
Sequence length 667
Comment pep:known_by_projection chromosome:PapAnu2.0:6:172756090:172822507:1 gene:ENSPANG00000019170 transcript:ENSPANT00000011569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGEGGCTAGRELEPGLGPGPGPGSELEPGEEFEIVDRSQLPGPGDLRSATRPRAAEGW
SAPILTLARRATGNLSASCGSALRAAAGLGGGDSGDGTARAASKCQMMEERANLMHMMKL
SIKVLLQSALSLGRSLDAEHAPLQQFFVVMEHCLKHGLKVKKSFIGQNKSFFGPLELVEK
LCPEASDIATSVRNLPELKTAVGRGRAWLYLALMQKKLADYLKVLIDNKHLLSEFYEPEA
LMMEEEGMVIVGLLVGLNVLDANLCLKGEDLDSQVGIIDFSLYLKDVQDLDGGKEHERIT
DVLDQKNYVEELNRHLSCTVGDLQTKIDGLEKTNSKLQEELSAATDRICSLQEEQQQLRE
QNELIRERSEKSVEELEKELELQIGMKTEMEIAMKLLEKDTHEKQDTLVALRQQLEEVKA
INLQMFHKAQNAESSLQQKNEAITSFEGKTNQVMSSMKQMEERLQHSERARQGAEERSHK
LQQELGGRISALQRQLSQLHEQCSSLEKELKSEKEHRQALQRELQHEKDTSCLLRTELQQ
VEGLKKELRELQDEKAELQKICEEQEQALQEMGLHLSQSKLKMEDIKEVNQALKGHAWLK
DDEATHCRQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDGCHTLLLQ
RCSSTAS
Download sequence
Identical sequences ENSPANP00000008740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]