SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008783 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008783
Domain Number 1 Region: 273-340
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000707
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number 2 Region: 55-79
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000641
Family CCCH zinc finger 0.0041
Further Details:      
 
Domain Number 3 Region: 207-232
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000017
Family CCCH zinc finger 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000008783
Domain Number - Region: 365-393
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00157
Family CCCH zinc finger 0.004
Further Details:      
 
Domain Number - Region: 87-108
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0549
Family CCCH zinc finger 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008783   Gene: ENSPANG00000010629   Transcript: ENSPANT00000009015
Sequence length 477
Comment pep:novel chromosome:PapAnu2.0:X:38024485:38025996:1 gene:ENSPANG00000010629 transcript:ENSPANT00000009015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAAAPGTTATTSGAGAAAAEAAAAVSPTPIPTVTAPSPRAGGGVGGSDGNSWTKQVTC
RYFVYGICKEGDNCRYSHDLSDRPCGVVCSCFQRGYCLYGDRCRCEHSKPLKQEEATATE
LTTESSLAASSSLSSIVGPLVEMNTNESESRNSNFATVGAGSEDWANAIEFVPGQPYCGR
TVPSCTEAPLQGPVTKEESEKEQTAVETKKELCPYAAVGQCRYGENCVYLHGDLCDICGL
QALHPMDAAQRSQHIQSCIEAHEKAMEFSFAVQRSKDRVCGICMEVVYEKANPSEHRFGI
LSNCNHTFCLKCIRKWRSAKEFESRIVKSCPQCRITSNFVIPSEYWVEEKEEKQKLIQKY
KKAMSNKACRYFDEGRGSCPFGENCFYKHVYPDGRREEPQRQQEETSSRHQAQGRNHFLE
FFEEGANSNPFDDEEEAVTFELGEMLLMLSTAGGDNELTDSEDVWDLFCDEFCALDL
Download sequence
Identical sequences ENSPANP00000008783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]