SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008903 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008903
Domain Number 1 Region: 1448-1639
Classification Level Classification E-value
Superfamily vWA-like 1.16e-44
Family Integrin A (or I) domain 0.00077
Further Details:      
 
Domain Number 2 Region: 1253-1444
Classification Level Classification E-value
Superfamily vWA-like 6.2e-44
Family Integrin A (or I) domain 0.0000000121
Further Details:      
 
Domain Number 3 Region: 1631-1855
Classification Level Classification E-value
Superfamily vWA-like 3.02e-35
Family Integrin A (or I) domain 0.0000000655
Further Details:      
 
Domain Number 4 Region: 631-692
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000000343
Family BSTI 0.086
Further Details:      
 
Domain Number 5 Region: 277-331
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000556
Family BSTI 0.05
Further Details:      
 
Domain Number 6 Region: 756-812
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000213
Family ATI-like 0.014
Further Details:      
 
Domain Number 7 Region: 2180-2235
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000213
Family BSTI 0.054
Further Details:      
 
Domain Number 8 Region: 1125-1178
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000018
Family ATI-like 0.03
Further Details:      
 
Domain Number 9 Region: 2550-2631
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000649
Family VWC domain 0.045
Further Details:      
 
Domain Number 10 Region: 810-877
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000879
Family VWC domain 0.034
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000008903
Domain Number - Region: 2404-2480
Classification Level Classification E-value
Superfamily FnI-like domain 0.00136
Family VWC domain 0.064
Further Details:      
 
Domain Number - Region: 682-723
Classification Level Classification E-value
Superfamily FnI-like domain 0.0067
Family VWC domain 0.034
Further Details:      
 
Domain Number - Region: 423-495
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 0.0196
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008903   Gene: ENSPANG00000026470   Transcript: ENSPANT00000010325
Sequence length 2794
Comment pep:known_by_projection chromosome:PapAnu2.0:11:6041965:6209747:-1 gene:ENSPANG00000026470 transcript:ENSPANT00000010325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGTFCAEGTRGRSSMARCSLFGSDFINTFDGSMYSFAGYCSYLLAGDCQKRSFSIIGEFQ
SGKRASLSVYLGEFFDIRLFVNGTVTQGDKSVSMPYASKGLYLETEAGYYKLSGEAYGFV
ARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTVTSDPYDFANSWALSSGE
QWCERASPPSSSCNISSGEVQKGLWEQCQLLKSTSVFARCHPLVDPEPFVALCEKTSCEC
AEGLECTCPAFLEYARTCAHEGMVLYGWTDHSACSPVCPAGMEYKQCVSPCARTCQSLHI
NEVCQERCMDGCSCPEGQLLDEGLCVESTECPCMHSGKRYPPSASLSRDCNTCICRNSQW
ICSNEECPGECLVTGQSHFKSFDNRYFTFSGICQYLLARDCQDHSFSIVIETVQCADDPD
AVCTRSVTIRLPGLHNSLVKLKHGGGVAMDGQDVQLPLLKGDLRIQHSVTASVRLSYGED
LQMDWDGRGRLLVKLSPVYAGKTCGLCGNYNGNQGDDFLTPSGLAEPRVEDFGNAWKLHA
DCQDLQKQHSDPCALNPRMTRFSEEACAVLTSPTFEACHRAISPLPYLRNCRYDVCSCSD
GRECLCGALASYAAACAGRGVRVAWREPGRCELKCPKGQVYLQCGTPCNLTCRALSYPDE
ECNEACLEGCFCPPGLYMDEMGDCVPKAQCPCYYDGEIFQPEDIFSDHHTMCYCEDGFMH
CTMSGVPGSLLPDAVLSSPLSHRSKRSLSCRPPMVKLVCPADNPRAEGLECAKTCQNYDL
ECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGEAVKIDCNTCVCRDRKWN
CTDHVCDATCSTIGMAHYLTFDGLKYMFPGECQYVLVQDYCGGDPGTFRILVGNEGCSHP
SVKCKKRVTILVEGGEIELFDGEVNVKRPMKDETHFEVVESGRYIILLLGKALSVVWDRH
LSISVVLKQTYQEKVCGLCGNFDGIQNNDLTSSNLQVEEDPADFGNSWKVSSQCADTRKV
PLDSSPATCHNLMKQTMVDSSCRVLTSDVFQDCNKLVDPEPFLDVCIYDTCSCESIGDCA
CFCDTIAAYAHVCAQHGKVVTWRTATLCPQSCEERNLRENGYECEWRYNSCAPACRVTCQ
HPEPLACPVQCVEGCHAHCPPGKILDELLQTCVSPEDCPVCEAAGRRFASGKKVTLNPSD
PEHCQICHCDGVNLTCEACKEPGGLVVPPTDAPVSPTTPYVEDISEPPLHDFYCSRLLDL
VFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPS
ELRRIASQVKYAGSQVASTSEVLKYTLFQIFGKIDRPEASRIALLLMASQEPQRMSRNFV
RYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQSPDNKAFVLSGVDELEQQRDEIVSYLC
DLAPEAPPPTLPPDMAQVTVGPGLLGVSTLGPKRNSMVLDVAFVLEGSDKIGEADFNRSK
EFMEEVIQRMDVGQDGIHVAVLQYSYTVAVEYPFSEAQSKGDILQRVREIRYQGGNRTNT
GLALQYLSEHSFLVSGDREQAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPHANVQEL
ERIGWPNAPILIQDFETLPREAPDLVLQSCCSGEGLKIPTLSPAPDCSQPLDVILLLDGS
SSFPAAYFDEMKSFAKAFISKANIGPHLTQVSVLQYGSITTIDVPWNVALEKAHLLSLVD
VMQREGGPSQIGNDALGFAVRYLTSEMHGARPGASKAVVILVMDVSVDAVDAAADAARSN
RVTVFPIGIGDRYDAAQLRILAGPAGNSNVVKLQRIEDLPTMVTLGNSFLHKLCSGFVRI
CMDEDGNERRPGDIWTLPDQCHTVTCQPDGQTLLKSHRVNCDRGLRPSCPNSQSPVKVEE
TCGCRWTCPCVCTGSSTRHIVTFDGQNFKLTGSCSYVLFQNKEQDLEVILHNGACSPAAR
QGCMKSIEVKHGALSVELHSDMEVTVNGRLVSVPYVGGNMEVNVYGAIMHEIRFNHLGHI
FTFTPQNNEFQLQLSPKTFASKTYGLCGICDENGANDFMLRDGTVTTDWKTLVQEWTVQR
PGQTCQPILEEQCLVPNSSQCQVLLSALFAECHKVLAPATFYAICQQDSCHREQVCEVIA
SYAHLCWTNGVCVDWRTPDFCAMSCPPSLVYNPCERGCPRHCDGNVSCGDHPSEGCFCPP
NKVMLEGSCVPEEACTQCIGEDGVQHQFLEAWVPDHQPCQICTCLSGRKANCTMQPCPTA
KAPTCGLCEVARLRQNADQCCPEYECVCDPESCDLPPVPHCEGGFQPTLTNPGECRPNFT
CACRKEECKRVSPPSCPPHRLPALRKTQCCDEYECACNCVNSTVSCPLGYLASTATNDCG
CTTTTCLPDKVCVHRSTIYPMGQFWEEGCDVCTCTDMEDAVMGLRVVQCSQKPCEDSCRS
GFTYVPREGECCGRCLPSACEVVTGSPRGDSQSSWKSVGSHWASPENPCLINECVRVKEE
VFVQQRNVSCPQLEVPVCPLGFQLSCKTSACCPSCHCEPVEACMLNGTMIGPGKSVMIDA
CTTCRCIVQVGIISGFKLECRKTICNPCPLGYKEENNTGECCGRCLPTTCTIRLRGGQIM
TLKRDETLQDGCDTHFCKVNERGEYFWEKRVTGCPPFDEHKCLAEGGKIMKIPGTCCDTC
EEPECNDITARLQYVKVGSCKSEVEVDIHYCQGKCASKAMYSIDINDVQDQCSCCSPTRT
EPMQVPLHCTNGSVVYHEVLNAMQCECSPRKCSK
Download sequence
Identical sequences ENSPANP00000008903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]