SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008979 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008979
Domain Number 1 Region: 49-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000319
Family V set domains (antibody variable domain-like) 0.042
Further Details:      
 
Domain Number 2 Region: 274-364
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000653
Family I set domains 0.026
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000008979
Domain Number - Region: 172-204
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0262
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008979   Gene: ENSPANG00000010825   Transcript: ENSPANT00000027462
Sequence length 414
Comment pep:novel chromosome:PapAnu2.0:16:51485840:51487084:1 gene:ENSPANG00000010825 transcript:ENSPANT00000027462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLALTTVLLWAWGGLQAFEIVEKENIFQKTPCPAFLMFENAAYLADMSFELPCHCKPEE
VPAVVWFYQKHLGSSHTKVLTDFDGRVLTEAAQVRVGSDMLARFSIRMFSLLVFRAQPED
SGLYFCGTRKGDYFYAYDVDIQNSEGMVATFQDEGQEPFADEYYGHLHVFTTFWEWTPCD
RCGVRGEQWRIGLCYLQSPDLSPRYLKAVPDVVSCGSRAVPRKLQTKARDHTPELLVRSC
IVPCEKTKTIREGVLAIVNYVSKVGSRPWVPQVPIQFHQQRLGHGLIISCPGARPEHAVA
WDKDRQHLYRTQYLKGVNRSMRVFIDHGNQLHIRFTQLDDRGIYYCWRQGVRVAGFRLGV
TSRGRYPASLSDPETRSAVELTLIGYLFITAVFVTIHLCRCCCYLFQCCPNFSP
Download sequence
Identical sequences ENSPANP00000008979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]