SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009332 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009332
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.11e-35
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 2 Region: 76-127
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 5.86e-17
Family Ribosomal protein L40e 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009332   Gene: ENSPANG00000005160   Transcript: ENSPANT00000002971
Sequence length 128
Comment pep:novel chromosome:PapAnu2.0:5:80332041:80332427:1 gene:ENSPANG00000005160 transcript:ENSPANT00000002971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIKPSLCQLAQKYNRNKMICRKCYARLHPRAVNCHKKKCGHTNN
LRPKKKVK
Download sequence
Identical sequences A0A096N9K8
ENSPANP00000009332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]