SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009371 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009371
Domain Number 1 Region: 66-197
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000133
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 206-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000839
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 512-807
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000522
Family Rhodopsin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009371   Gene: ENSPANG00000011401   Transcript: ENSPANT00000025544
Sequence length 819
Comment pep:known_by_projection chromosome:PapAnu2.0:19:13531808:13563893:-1 gene:ENSPANG00000011401 transcript:ENSPANT00000025544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGRVFLAFAAFCVWLTLLGAETQDSRDCARWCPENSSCVNATACRCNPGFSASSEIFTS
PTEICDDINECVPPSKVSCGKSSYCRNTKGSYDCGCSPGYELVSGAKTFKNESENTCQDV
DECQQNPRLCKSYGTCVNTPGSFTCQCLPGFKFKPEDPKLCTDVNECTFGQNPCHSSTHC
LNNVGSYQCRCRPGWQPIPGSPNGPNNTICEDVDECSSGLHQCDNSTVCFNIVGSYTCRC
RPGWEPKHGIPNNQKDTVCEEMNFPTWTPPPGVHSQTLSQFFNKVQDLGRDFKTSSAKVT
IQSILKGLDELLEAPGDLETLPRFQQHCVATHLLDGLENVLRGLSKNLSIGLLNFSYPAG
TEFSLEVQKQVDRNVTLRQNQATMQLDWSLAQKSGDPGPSVVGLVSVPGMGKLLAEAPLV
SEPEKQVVLNETHQGLLPILLSDVISAFLSNNDTQNLSSPVTFTFSHRSVIPRRKVFCVF
WERGQNGCGHWATTGCSTMGTRDTSTICRCTHLSSFAVLMAPYDVQEEDPVLTVITYMGL
SLSLLCLLLAVLTFLLCKAIQNTSTSLHLQLSLCLLLAHLLFLVAIDRTEHEVLCAIIAG
ALHYLYLAAFTWMLLEALYLFLTARNLMVVNYSSINRFTKKLMFPMGYGVPAVIVAISAA
SRPHLYGTPSHCWLQPEKGFIWGFLGPVCAIFSVNLALLLVTLWILKNRLSSLNNEVSTL
QNTRMLAFKATIQLFILGCTWCLGVLQVGPAAQVMAYLFTIINSLQGVFIFLVYCLLSQQ
VREQYRKWSKGFRKLRTESEMHTLSSSAKADTPKPSTVR
Download sequence
Identical sequences ENSPANP00000009371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]