SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009415 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009415
Domain Number 1 Region: 400-545
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-26
Family MAM domain 0.0012
Further Details:      
 
Domain Number 2 Region: 103-209
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000345
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 219-254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000105
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000009415
Domain Number - Region: 60-102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0318
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009415   Gene: ENSPANG00000013985   Transcript: ENSPANT00000027381
Sequence length 554
Comment pep:known_by_projection chromosome:PapAnu2.0:X:10884765:10948710:1 gene:ENSPANG00000013985 transcript:ENSPANT00000027381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPWSLALPLLLPWVAGGFGNAASARHHGLLASARQPGVCHYGTRLACCYGWRRNSKGV
CEATCEPGCKFGECMGPNKCRCFPGYTGKTCSQDVNECGMKPRPCQHRCVNTHGSYKCFC
LSGHMLMPDATCVNSRTCAMTNCQYGCEDTEEGPQCLCPSSGLLLAPNGRVCLDIDECAS
GKAICPYNRRCVNTFGSYYCKCHIGFELQYISGQYECMDINECTMDSHTCSHHANCFNTQ
GSFKCKCKQGYKGNGLRCSAIPQNSVKEVLRAPGTIKDRIKKLLAHKNSMKKKVKIKNVT
PEPTSTPTPKVNLQPFNYEDSVSRGGNSHGDKKGNEEKTKEGLEEEKREEKALKNDIEER
SLRGDVFFPKVNEAGEFGLVLVQRKALTSKLEYKADLNISVDCSFDHGICDWKQDREDDF
DWNPADRDNAIGYYMAVPALAGHKKDIGRLKLLLPDLQPQSNFCLLFGYRLAGDKVGKLR
VFVKNSNNALAWEETTSEDEKWKTGKIQLYQGTDATKSIVFEAERGKGKTGEIAVDGVLL
VSGLCPDSLLSVDD
Download sequence
Identical sequences A0A096N9S9
ENSPANP00000009415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]