SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009601 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009601
Domain Number 1 Region: 146-389
Classification Level Classification E-value
Superfamily vWA-like 3.25e-77
Family Integrin A (or I) domain 0.000000549
Further Details:      
 
Domain Number 2 Region: 390-476
Classification Level Classification E-value
Superfamily Integrin domains 7.32e-20
Family Integrin domains 0.0018
Further Details:      
 
Domain Number 3 Region: 44-102
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000011
Family Plexin repeat 0.00056
Further Details:      
 
Domain Number 4 Region: 594-633
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000024
Family Integrin beta EGF-like domains 0.0056
Further Details:      
 
Domain Number 5 Region: 550-588
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000009601
Domain Number - Region: 513-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0022
Family Integrin beta EGF-like domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009601   Gene: ENSPANG00000006887   Transcript: ENSPANT00000025245
Sequence length 791
Comment pep:known_by_projection chromosome:PapAnu2.0:3:90475891:90555752:-1 gene:ENSPANG00000006887 transcript:ENSPANT00000025245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGSALAFFTAAFVCLQNDRRGPASFLWAAWVLSLVLGLGQGEDNICASSNVASCARCLA
LGPECGWCVQEDFISGGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTP
GEVSIQLRPVELGAEANFMLKIHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKM
AFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEF
EKAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLA
GIVVPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPL
LPGTIAGEIESKAANLNNLVVEAYQKLISEVKVHVENQVRGVYFNITAICPDGSRKPGME
GCRNVTSNHEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGP
KGKCVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIK
LGKVYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSK
GQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCHTACKENWNCVQCLHPHNLSQAILDQC
KTSCALMEQQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIK
SSSDYRVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRISLYMSQTTGL
IKCQVTTAIKN
Download sequence
Identical sequences ENSPANP00000009601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]