SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009807 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009807
Domain Number 1 Region: 483-737
Classification Level Classification E-value
Superfamily YWTD domain 1.16e-50
Family YWTD domain 0.00000369
Further Details:      
 
Domain Number 2 Region: 46-300
Classification Level Classification E-value
Superfamily YWTD domain 9.42e-37
Family YWTD domain 0.0000639
Further Details:      
 
Domain Number 3 Region: 400-492,733-784
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000022
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 974-1018
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000153
Family EGF-type module 0.00022
Further Details:      
 
Domain Number 5 Region: 349-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000013
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 833-951
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000149
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000009807
Domain Number - Region: 324-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00212
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009807   Gene: ENSPANG00000006015   Transcript: ENSPANT00000009076
Sequence length 1158
Comment pep:known_by_projection chromosome:PapAnu2.0:5:101058973:101156885:1 gene:ENSPANG00000006015 transcript:ENSPANT00000009076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLTLIILLPVVLKFSCVSLSAPQHWSCPEGTPAGHGNSTRVGPAPFLIFSHGNSIFRID
TEGTNYEPLVVDAGVSVIMDFHYKEKTIYWVDLERQLLQRVFLNGSRQERVCNIEKNVSG
MAINWINEEVIWSNQQEGIITVTDMKGNNSHVLLSALKYPANIAVDPVERFIFWSSEVAG
SLYRADLDGVEVKSLLETSEKITAVSLDVLDKRLFWIQYSREGSNSLIGSCDYDGGSVRV
SKHPTQHNLFAMSLFGDHVFYSTWKTRTIWIANKHTGKDMVRINLHPSFVPPGELKVVHP
LAQPKAEDDAREREQKLHKSRKGNCSSTVCGQDAQSHLCTCAEGYALSRDRKYCEDVNEC
AFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCPSNVSECSHDCVLTSEGPL
CFCPEGSVLERDGKTCSGCSSPDNGGCSQLCIPLSPVSWECDCFPGYDLQLDKKSCVASG
PQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVYALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLIEEGVDVPEGLAVDWIGRRFYWTDRGKSLIGRSDLNGKHPKIIIKENISQP
RGIAVHPMAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPNGITIDFLTDKLYWCD
AKQSVIEMANLDGSKRRTLTQNDVGHPFAVAVFEDYVWFSDWAMPSVIRVNKKTGKDRVR
LQGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKERLGTAWCLCREGFMKASDGKTC
LALDGHQLLAGGEVDLKNQVTPLDTLSKTRVSEDHITESQHMLVAEITVSDQYDCAPVGC
STYARCVSEGEDVTCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCQCS
EGYRGDGIHCLDIDECQLGVHSCGENANCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHL
REDGHHYSVRNSDSGCPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW
ELRHAGHGQQQKVTVVAVCVVVLVVLLLLSLWGAHYYRTQKLLTKNPKNPSEESSRDARS
RRPADSEDGMSSCPQPWFVVTKEHQDLRNGSQPVAGEDGQAADVGSVQPTSWRQKPQLCG
VGQAAGFQYPVIRAPVPR
Download sequence
Identical sequences ENSPANP00000009807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]