SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009958 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009958
Domain Number 1 Region: 3787-3967
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-35
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 2 Region: 3090-3201
Classification Level Classification E-value
Superfamily Cadherin-like 5.1e-30
Family Cadherin 0.0018
Further Details:      
 
Domain Number 3 Region: 1519-1655
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-30
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 3189-3301
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 5 Region: 3300-3411
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-28
Family Cadherin 0.00059
Further Details:      
 
Domain Number 6 Region: 2773-2881
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-28
Family Cadherin 0.0012
Further Details:      
 
Domain Number 7 Region: 424-543
Classification Level Classification E-value
Superfamily Cadherin-like 1.11e-27
Family Cadherin 0.0011
Further Details:      
 
Domain Number 8 Region: 993-1111
Classification Level Classification E-value
Superfamily Cadherin-like 1.24e-27
Family Cadherin 0.0014
Further Details:      
 
Domain Number 9 Region: 894-997
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-26
Family Cadherin 0.0018
Further Details:      
 
Domain Number 10 Region: 2245-2351
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-25
Family Cadherin 0.00092
Further Details:      
 
Domain Number 11 Region: 110-233
Classification Level Classification E-value
Superfamily Cadherin-like 2.88e-25
Family Cadherin 0.0015
Further Details:      
 
Domain Number 12 Region: 1728-1848
Classification Level Classification E-value
Superfamily Cadherin-like 7e-25
Family Cadherin 0.0015
Further Details:      
 
Domain Number 13 Region: 2988-3096
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-24
Family Cadherin 0.0013
Further Details:      
 
Domain Number 14 Region: 1105-1211
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-24
Family Cadherin 0.0012
Further Details:      
 
Domain Number 15 Region: 783-887
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-24
Family Cadherin 0.00089
Further Details:      
 
Domain Number 16 Region: 2553-2690
Classification Level Classification E-value
Superfamily Cadherin-like 6.67e-24
Family Cadherin 0.0034
Further Details:      
 
Domain Number 17 Region: 1419-1523
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-23
Family Cadherin 0.00081
Further Details:      
 
Domain Number 18 Region: 2037-2145
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-22
Family Cadherin 0.0031
Further Details:      
 
Domain Number 19 Region: 2882-2986
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-22
Family Cadherin 0.0017
Further Details:      
 
Domain Number 20 Region: 683-795
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-21
Family Cadherin 0.0021
Further Details:      
 
Domain Number 21 Region: 3399-3518
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-21
Family Cadherin 0.002
Further Details:      
 
Domain Number 22 Region: 1631-1734
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-21
Family Cadherin 0.0018
Further Details:      
 
Domain Number 23 Region: 2455-2565
Classification Level Classification E-value
Superfamily Cadherin-like 2.49e-21
Family Cadherin 0.0038
Further Details:      
 
Domain Number 24 Region: 2352-2452
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 25 Region: 2145-2252
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 26 Region: 1207-1321
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-20
Family Cadherin 0.0031
Further Details:      
 
Domain Number 27 Region: 1836-1959
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-20
Family Cadherin 0.0017
Further Details:      
 
Domain Number 28 Region: 1945-2049
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000143
Family Cadherin 0.0026
Further Details:      
 
Domain Number 29 Region: 1326-1425
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000144
Family Cadherin 0.013
Further Details:      
 
Domain Number 30 Region: 535-636
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000196
Family Cadherin 0.003
Further Details:      
 
Domain Number 31 Region: 2670-2779
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000214
Family Cadherin 0.0044
Further Details:      
 
Domain Number 32 Region: 339-436
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000457
Family Cadherin 0.0071
Further Details:      
 
Domain Number 33 Region: 3512-3602
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000314
Family Cadherin 0.0046
Further Details:      
 
Domain Number 34 Region: 4063-4100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000947
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 35 Region: 3988-4026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000071
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 36 Region: 4025-4067
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000117
Family EGF-type module 0.018
Further Details:      
 
Domain Number 37 Region: 223-321
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000443
Family Cadherin 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000009958
Domain Number - Region: 36-122
Classification Level Classification E-value
Superfamily Cadherin-like 0.000817
Family Cadherin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009958   Gene: ENSPANG00000018585   Transcript: ENSPANT00000015542
Sequence length 4557
Comment pep:known_by_projection chromosome:PapAnu2.0:14:82147280:82695685:1 gene:ENSPANG00000018585 transcript:ENSPANT00000015542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIIMGHCVGARPPPCCLILLLFKLLATVSQGLPGTGPLAWDIKYRIVSGDEEGFFKAEE
VIIADFCFLRIRTKGGNSAILNREIQDNYLLIVKGSVRGEDLEAWTKVNIQVLDMNDLRP
LFSPTTYSVTIAESTPLRTSVAQVTATDADIGSNGEFYYYFKNKVDLFSVHPTSGVISLS
GRLNYDEKNRYDLEILAVDRGMKLYGNNGVSSTAKLYVHIERINEHAPTIQVVTHVPFSL
EKEPTYAVVTVDDLDDGANGEIESVSIVAGDPLDQFFLAKEGKWLNEYKIKERKQIDWES
FPYGYNLTLQAKDKGSPQKFSALKAVHIGNPTRDTVPVRFEKEVYDVSVSEFSPPGVVVA
IVKLSPEPIDVEYKLSPGEDAVYFKINPRSGLIVTAQPLNTVKKEVYKLEVTNKEGDLKT
QVTISIEDANDHTPEFQQPLYDANVNESVPVGTSVLTVSASDKDKGENGYITYSIASLNL
LPFAINQFTGVISTTEELDFESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSP
LFEKVACQGVISYDFPVGGHITAVSAIDIDELELVKYKIISGNELGFFYLNPDSGVLQLK
KSLTNSGIKNGNFALRITATDGENLADPMSINISVLHGKVSSKSFSCRETRVAQKLAEKL
LIKAKANGKLNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSG
FNGKVLFTISDGNTDSCFNIDMETGQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRL
LTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQ
FAINSSTGIVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAF
IPSSYSVKVLEDLPVGTVIAWLETHDPDLGLGGQVRYSLVNDYNGRFEIDKASGAIRLSK
ELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENS
RIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGRFSIDDESGVITAADILDRETTGSYWL
TVYATDRGVVPLYSTIEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDISVIQIQAEDPD
SSSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLELTLRDGGIIGKKS
VMWWVVVQVLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSI
VDGNDDGKFFIDPKTGMVSSRKQFTAGSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPP
SPIPLTFDEPFYNFTVMESDRVTEIVGVVSVQPANTPLWFDIVGGNFDSAFDAEKGVGTI
VIAKPLDAEQRSIYNMSVEVTDGTNVAVTQVFIKVLDNNDNGPEFSQPNYDVTISEDVLP
DTEILQIEATDRDEKHKLSYTVHSSIDSISMRKFRIDPSTGVLYTAERLDHEAQDKHILN
IMVRDQEFPYRRNLARVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDK
GENAELIYTIEAGNTGNTFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATA
IVRISVTMSDNSHPKFIHKDYQAEVNENVDIGTSVILISAISQSTLIYEVKDGDINGIFT
INPYSGVITTRKVLDYERTSSYQLIIQATNMAGMASNATVNIQIVDENDNAPVFLFSQYS
GSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGAIRT
IANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETVLLLP
TYVGVEVLKVSATDPDSEVPPELTYSLMEGSLDHFLIDSNSGVLTIKNNNLSKDHYMLIV
KVSDGKFYSTSMVTIMVKEAMDSGLHFTQSFYSTSISENNTNITKVAIVNAVGNRLNEPL
KYSILNPGNKFKIKSTSGVIQTTGVPFDREEQELYELVVEASRELDHLRVARVVVRVNIE
DINDNSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKDKGPNGEVTYVLQDDYGHFEINPN
SGNVILKEAFNSDLSNIEYGVTILAKDGGKPSLSTSVELPITIVNKAMPVFDKPFYTASV
NEDIRMNTPILSINATSPEGQGIIYIIIDGDPFKQFNIDFDTGVLKVVSPLDYEVTSAYK
LTIRASDALTGARAEVTVDLLVNDVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDAD
SENNKMVHYHIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSTDSGFPSLS
SEVLVHIYISDVNDNPPVFNQLIYESYVSELAPRGHFVTCVQASDADSSDFDRLEYSILS
GNDRTSFLMDSKSGVITLSNHRKQRMEPLYSLNVSVSDGLFTSTAQVHIRVLGANLYSPA
FSQSTYVAEVRENAAAGTKVIHVRATDGDPGTYGQISYAIINDFAKDRFLIDSNGQVITT
ERLDRENPLEGDVSIFVRALDGGGRTTFCTVRVIVVDENDNAPQFMTVEYRASVRADVGR
GHLVTQVQAIDPDDGANSRITYSLYSEASVSVADLLEIDPDNGWMVTKGNFNQLKNTVLS
FFVKAVDGGIPVKHSLIPVYIHVLPPETFLPSFTQSQYSFTIAEDTAIGSTVDTLRILPS
QNVRFSTVNGERPENNKGGVFVIEQETGTIKLDKRLDHETSPAFHFKVAATIPLDKVDIV
FTVDVDIKVLDLNDNKPVFETSSYDTIIMEGMPVGTKLTQVRAIDMDWGANGQVTYSLHS
DSQPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVT
DINDNAPVFAQEVYRGNVKESDPPGEVVAVLSTWDRDTSDINRQVSYHITGGNPRGRFAL
GLVQSEWKVYVKRPLDREEQDIYFLNITATDGLFVTQAMVEVSVSDVNDNSPVCEQVAYT
ALLPEDIASNKIILKVSAKDADIGSNGDIRYSLYGSGNSEFFLDPESGELKTLALLDRER
VPVYSLMAKATDGGGRFCQSNIHLILEDVNDNPPVFSSDHYNACVYENTATKALLTRVQA
VDPDVGINRKVVYSLADSAGGVFSIDSSSGIIILEQPLDREQQSSYNISVRATDQSPGQS
LSSLTTVTITVLDINDNPPVFERRDYLVTVPEDTSAGTQVLAVFATSKDIGTNAEITYLI
RSGNEQGKFKINPKTGGISVSEVLDYELCKRFYLVVEAKDGGTPALSAVATVNINLTDVN
DNPPKFSQDVYSAVISEDALVGDSVILLIAEDVDSQPNGQIHFSIVNGDRDNEFTVDPVL
GLVKVKKKLDRERVSGYSLLVQAVDSGIPPMSSTATLNIDISDVNDNSPVFTPANYTAVI
QENKPVGTSILQLVVTDRDSFHNGPPFSFSILSGNEEEEFVLDSHGILRSAVVFQHTESP
EYVLCVQAKDSGKPQQVSHTYIRVRVIEESTHKPTAIPLEIFIVTMEDDFPGGVIGKIHA
TDQDMYDVLTFALKSEQKSLFKVNSHDGKIIALGGLDSGKYVLNVSVSDGRFQVPIDVVV
HVEQLVHEMLQNTVTIRFENVSPEDFVGLHMHGFRRTLRNAVLTQKQDSLHIISIQPVAG
TNQLDMLFAVEMHSSEFYKPAYLIQKLSNARRHLENIMRISAILEKNCSGLDCQEQHCEQ
GLSLDSHALMTYSTARISFVCPRFYRNVRCTCNGGLCPGSNDPCVEKPCPGDMQCVGYEA
SRRPFLCQCPPGKLGECSGHTSLSFAGNSYIKYRLSENSKEEDFKLALRLRTLQSNGIIM
YTRANPCIILKIVDGKLWFQLDCGSGPGILGISGRAVNDGSWHSVFLELNRNFTSLSLDD
SYVERRRAPLYFQTLSTESSIYFGALVQADNIRSLTDTRVTQVLSGFQGCLDSVILNNNE
LPLQNKRSSFAEVVGLTELKLGCVLYPDACERSPCQHGGSCTGLPSGGYQCTCLSQFTGR
NCESEITACFPNPCRNGGSCDPIGNTFICNCKAGLTGVTCEEDINECEREECENGGSCVN
VFGSFLCNCTPGYVGQYCGLRPVVVPNIQAGHSYVGKEELIGIAVVLFVIFILVVLFIVF
RKKVFRKNYSRNNITLVQDPATAALLNKSNGIPFRNLRGSGDGRNVYQEVGPPQVPVRPM
AYTPCFQSDSRSNLDKIVDGLGGEHQEMTTFHPESPRILTARRGVVVCSVAPNLPAVSPC
RSDCDSIRKNGWDAGTENKAVDDPGEVTCFAGSNKGSNSEVQSLSSFQSDSGDDNGPQAS
IVTVIQLVNNVVDTIENEVSVMDQGQNYNRAYHWDTSDWMPGARLSDIEEVPNYENQDGG
SAHQGSTRELESDYYLGGYDIDSEYPPPHEEEFLSQDQLPPPLPEDFPDQYEALPPSQPV
SLASTLSPDCRRRPQFHPSQYLPPHPFPNETDLVGPPASCEFSTFAVSMNQGTEPTGPAD
SVSLSLHNSRGTSSSDVSANCGFDNSEVAMSDYESVGELSLASLHIPFVETQHQTQV
Download sequence
Identical sequences ENSPANP00000009958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]