SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009975 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000009975
Domain Number - Region: 228-265
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0107
Family Apolipoprotein A-I 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009975   Gene: ENSPANG00000000276   Transcript: ENSPANT00000027417
Sequence length 272
Comment pep:novel chromosome:PapAnu2.0:4:64198507:64199322:1 gene:ENSPANG00000000276 transcript:ENSPANT00000027417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQWNVPRTVSRLARRTCLETHNAGLFGRCQNVKGPLLLYNADSKVVLVQGLQKQWLNLSA
AQCVAKERRPLDAHSPQPGVLRHKQGKQHVSFKRVFSSSATAQGTPEKKEEPDPLQDKSI
SLYQRFKKTFRQYGKVLIPVHLITSGVWFGTFYYAALKGVNVVPFLELIGLPDSVVSILK
NSQSGNALTASALFKIATPARYTVTLEGTSFTVKYLHSHGYMSTPPLIKEYLQDRMEETK
ELITEKMEETKDRLTEKLQETKEKVSFKKKVE
Download sequence
Identical sequences A0A096NB58
ENSPANP00000009975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]