SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010414 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010414
Domain Number 1 Region: 867-1048
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.62e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0038
Further Details:      
 
Domain Number 2 Region: 1023-1142
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 
Domain Number 3 Region: 158-192,231-377
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-31
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 4 Region: 3-163
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-20
Family Phosphotyrosine-binding domain (PTB) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010414   Gene: ENSPANG00000015230   Transcript: ENSPANT00000001607
Sequence length 1263
Comment pep:known_by_projection chromosome:PapAnu2.0:5:32624353:32856748:1 gene:ENSPANG00000015230 transcript:ENSPANT00000001607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTARKHPLPNEVSVDFGLHLVGSLPVHSLTTMPMLPWVVAEVRRLSRQSSRKEPV
TKQVRLCVSPSGLRCEPEPGRSQQWDPLICSSIFECKPQHVHKLIHNSHDPSYFACLIKE
DAVHRQSICHVFKADDQTKVPEIISSIRQAGKIARQEELHCPSEFDDTFSKKFEVLFCGR
VTVAHKKAPPALIDECIEKFNHVSGSLGSESPRPAPPHAAPTWSQEPGRRPMRKSFSQPG
LRSLAFRKELQDGGLRSSGFFSSFEESDIENHLISGHNIVQPTDIEENRTMLFTIGQSEV
YLISPDTKKIALEKNFKEISFCSQGIRHVDHFGFICRESSGGGGFHFVCYVFQCANEALV
DEIMMTLKQAFTVAAVQQTAKAPAQLCEGCPLQGLHKLCERIEGMNSSKTKLELQKHLTT
LTNQEQATIFEEVQKLRPRNEQRENELIISFLRCLYEEKQKEHIHIGEMKQTSQIAAENI
GSELPPSATRFRLDLLKNKAKRSLTESLESILSRGNKARGLQEHSSSVDLDSSLSSTLSN
TSKEPSVCEKEALPISESSFKLLGSSEDLSSDSESHLPEEPAPLSPQQAFRRRANTLSHF
PMECQEPPQPARGSPGVSQRKLMRYHSVSTETPHERNVDPSPVGESKHRPGQSSAPAPPP
RLNPSASSPNFFKYLKHNSSGEQSGNAVPKSISYRNALRKKLHSSSSVPNFLKFLAPVDE
NNTSDFMNTKRDFESKANHLGDSGGTPVKTRRHSWRQQIFLRVATPQKACDASSRYEDYS
ELGELPPRSPLEPVCEDGPFGPPPEEKKRTSRELRELWQKAILQQILLLRMEKENQKLQA
SENDLLNKRLKLDYEEITPCLKEVTTVWEKMLSTPGRSKIKFDMEKMHSAVGQGVPRHHR
GEIWKFLAEQFHLKHQFPSKQQPKDVPYKELLKQLTSQQHAILIDLGRTFPTHPYFSAQL
GAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGILLLHMSEEEAFKMLKFLMFDVGLRKQY
RPDMIILQIQMYQLSRLLHDYHRDLYNHLEEHEIGPSLYAAPWFLTMFASQFPLGFVARV
FDMIFLQGTEVIFKVALSLLGSHKPLILQHENLETIVDFIKNTLPNLGLVQMEKTINQVF
EMDIAKQLQAYEVEYHVLQEELIDSSPLSDNQRMDKLEKTNSSLRKQNLDLLEQLQVANG
RIQSLEATIEKLLSSESKLKQAMLTLELERSALLQTVEELRRGSASPSDLREPECTQPKP
TGD
Download sequence
Identical sequences A0A096NC75
ENSPANP00000010414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]