SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010553 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010553
Domain Number 1 Region: 18-146
Classification Level Classification E-value
Superfamily PH domain-like 8.2e-28
Family Phosphotyrosine-binding domain (PTB) 0.0082
Further Details:      
 
Domain Number 2 Region: 272-392
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000775
Family SH2 domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010553   Gene: ENSPANG00000020849   Transcript: ENSPANT00000021291
Sequence length 427
Comment pep:known_by_projection chromosome:PapAnu2.0:1:23019138:23031813:-1 gene:ENSPANG00000020849 transcript:ENSPANT00000021291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKAGAGGRRASDCGLAPHRPRCITKFAQYVGSFPVDDLDTQESVWLVQQQLWALKDCPR
RRAVILKFSLQGLKIYSGEGEVLLMAHALRRILYSTWCPADCQFAFVARNPRSPASKLFC
HLFVGSQPGEVQILHLLLCRSFQLAYLLQHPEERALPEPCPGPIGEVPLKSLSSSGGPPG
GLVREPFGRDQLSQNVHALVSFRRLPAEGLVGSGKELPESEGRARHARLGNPYCSPTLVR
KKAIRSKVIRSGAYRGCTYETQLQLSAREAFPTAWEAWPRGPGGHSCLVESEGSLTENIW
AFAGISRPCALALLRRDVLGAFLLWPEPGASGQWCLSVRTQCGVVPHQVFRNHLGRYCLE
HLPAEFPSLEALVENHAVTERSLFCPLDMGRLNPTYEEQDCGPPGRPLRTLRPLSHAKSE
AELQGLG
Download sequence
Identical sequences A0A096NCK6
ENSPANP00000010553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]