SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010828 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010828
Domain Number 1 Region: 162-294
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.51e-16
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 33-165
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000314
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 278-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000438
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010828   Gene: ENSPANG00000001161   Transcript: ENSPANT00000004783
Sequence length 443
Comment pep:known_by_projection chromosome:PapAnu2.0:14:8236966:8243210:1 gene:ENSPANG00000001161 transcript:ENSPANT00000004783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPCASCLPGSLLLWALLLLLLGSASPQDSEEPDSYTECTDGYEWDPDSQHCRDVNECLT
IPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQES
CVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNL
PGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYGTFLCRCHQGYELHRDGFS
CSDIDECSYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRLCQDIDECESGAHQCSEAQTC
VNFHGGYRCVDTNRCVEPYVQVSDNRCLCPASNPLCREQPSSIVHRYMTITSERSVPADV
FQIQATSVYPGAYNAFQIRAGNSQGDFYIRQINNVSAMLVLARPVTGPREYVLDLEMVTM
NSLMSYRASSVLRLTVFVGAYTF
Download sequence
Identical sequences A0A096ND84 A0A2K5JSK3 A0A2K5N0D6 A0A2K5Y1P0 A0A2K6DUB3 A0A2K6LCA3 A0A2K6PQA3
ENSPANP00000010828 XP_010364758.1.97406 XP_011797869.1.43180 XP_011820591.1.47321 XP_011897031.1.92194 XP_017712663.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]