SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010833 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010833
Domain Number 1 Region: 911-964
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000042
Family SH3-domain 0.002
Further Details:      
 
Domain Number 2 Region: 551-728
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000112
Family RUN domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010833   Gene: ENSPANG00000006655   Transcript: ENSPANT00000024950
Sequence length 967
Comment pep:known_by_projection chromosome:PapAnu2.0:1:129164126:129174626:1 gene:ENSPANG00000006655 transcript:ENSPANT00000024950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HKTLSAGGGSELRHAHARRGADALRRVGCASAPPLPLCAPPGGDRGSRGQAQGRSGSRRT
LVCTCGCQGSPLASAGPGTCSPDSFCCSPDSCSGASSSPDPGLDSNCNALTTCQDLPSPG
LEEEDESAEQDLPTSELLEADDGKIDAGKTEPSWKINPIWKIDTEKTKAEWKTTENNNTG
WKNNGNVNSSWKNEPEKFDSGWKTNTRITDSGSKTDAGKIDGGWRSDVSEEPVPHRTITS
FHELAQKRKRGPGLPLVPQAKKDRSDWLIVFSPDTELPPSGSLGGSSAPPREVTTFKELR
SRSRAPPPPVPPRDPPAGWALVPPRPPPPPVPPRRKKNRPGLQPIAEGQSEEGRAVSPAA
GEEAPAAKEPGEPGAQAGLEAGPLLLPRPLVFRFSADGRPLLEGGGAGAAGSLLLAPLAG
WPGAGLRLLGAPSPSEEQLLPVRLSPVGAYSPPTRGALPCLASPELALLLSPLFPRSSTF
PAAAPPPRQVPAPPLPPQPRPPKAPRWTRSPSPPPRLLRSSWSFAGVSGAQRLWMAEAQS
GTGQLQEQKKGLLIAVSASVDKIISHFGAARNLVQKAQLGDSRLSPDVGHLVLTTLCPAL
HALVADGLKPFRKDLITGQRRSSPWSVVEASVKPGSSTRSLGTLYSQVSRLAPLSSSRSR
FHAFILGLLNTKQLELWFSSLQEDAGLLSLLYLPTGFFSLAHGGCPSLSTELLLLLQPLS
VLTFHLDLLFEHHHHLPLGPPQAPAPPGPPPALQQTMQAMLHLGGRLAQSLRGTSKEAAP
DPSDSPNLPTPGSWWEQLTQASRVYASGGTEGFPLSRWAPGHHGTAAEEGAQERPLPTDE
MAPGRGLWLGRLFGVPGGPTENESGALKSRRPSSWLPPTVSVLALVKRGAPPETPSPQEL
EASAPSMVQTHRAVRALCDHTAARPDQLSFRRGEVLRVITTVDEDWLRCGRDGVEGLVPV
GYTSLVL
Download sequence
Identical sequences ENSPANP00000010833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]