SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010962 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010962
Domain Number 1 Region: 1004-1185
Classification Level Classification E-value
Superfamily Fibronectin type III 7.01e-18
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 2 Region: 696-765
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000806
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 3 Region: 753-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000133
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 4 Region: 908-986
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000786
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 5 Region: 386-425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000109
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 6 Region: 311-354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000178
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 7 Region: 621-656
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000086
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 8 Region: 798-904
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000173
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 9 Region: 431-470
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000201
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 653-696
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000393
Family EGF-type module 0.016
Further Details:      
 
Domain Number 11 Region: 543-662
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000675
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number 12 Region: 351-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000131
Family EGF-type module 0.02
Further Details:      
 
Domain Number 13 Region: 1310-1346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000161
Family EGF-type module 0.021
Further Details:      
 
Domain Number 14 Region: 272-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000105
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 15 Region: 473-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000345
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000010962
Domain Number - Region: 508-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0121
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010962   Gene: ENSPANG00000012985   Transcript: ENSPANT00000020517
Sequence length 1413
Comment pep:known_by_projection chromosome:PapAnu2.0:12:102782409:102866437:1 gene:ENSPANG00000012985 transcript:ENSPANT00000020517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLGVAWSLLVAAALGLGARGVRGAVALADFYPFGAARGDAVTPKQDDGGSGLRPLSVPF
PFFGAEHSGLYVNNNGIISFLKEVSQFTPVAFPIAKDRCVVAAFWADVDNRRAGDVYYRE
ATDPATLRRATEDVRHYFPELLDFNATWVFVATWYRVTFFGGSSSSPVNTFQTVLITDGK
LSFTIFNYESIVWTTGTHASSGGNATGLGGIAAQAGFNAGDGQRYFSIPGSRTADMAEVE
TTTNVGVPGRWAFRIDDAQVRVGGCGHTTSVCLTLRPCLNGGKCIDDCVTGNPSYTCSCL
SGFTGRRCHLDVNECASQPCQNGGTCTHGINSFRCQCPAGFGGPTCETAQSPCDTKECQN
GGQCQVENSSAVCVCQAGYTGAACETDVDDCSPDPCLNGGSCVDLVGNYTCLCAEPFKGL
HCETGDHPVPDACLSAPCHNGGTCVDADQGYVCECPEGFMGLDCRQRVPDDCECRNGGRC
LGANTTLCQCPPGFFGLLCEFEITAMPCNMNTQCPDGGYCMEHGGSYLCVCHTDHNASHS
LPSPCDSDPCFNGGSCDAHDDSYICECPRGFHGKHCEKARPHLCSSGPCRNGGTCKEAGG
EYHCSCPYRFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDCPPGFSGRHCEIAPSP
CFRSPCVNGGTCEDRGTDFFCHCQVGYTGRWCQAEVDCGPPEEVKHATLRFNGTQLGAVA
LYACDRGYSLSAPSRIRVCQPHGVWSEPPQCLEIDECRSQPCLHGGSCQDHVAGYLCLCS
TGYEGTHCELERDECRAHLCRNGGSCRNLPGAYVCQCPAGFVGVHCETEVDACDSSPCQH
GGRCESGGGAYLCVCPEGFFGYHCETASDPCFSSPCGGRGYCLASNGSHSCTCKVGYTGK
DCAKELFPPTALKMERVEESGVSISWNPPDGPAARQMLDGYAVTYVSSDGSYRRTDFVDR
TRSSHQLRALAAGRAYNISVFSVKRNTNNKNDISRPAVLLARTRPRPVEVFEVTNVTAST
ISVQWALHRIHHATVSGVRVSIRHPEALRDQATDVERSVDRFTFGALLPGRRYTIQLTTL
SGLRGEEHPTESLATAPTHVWTRPLPPANLTAARVTATSAHVVWDAPTPGSLLEAYVINV
TTSQSTKSRYVPNGKLASYTVRDLLPGRRYQLSVTAVQGTELGPLHSEPAHLYIITSPRD
GTDRRWHQGGHHPRVLRNRPPPVRLPELRLLNDHSAPETPTQPPRFSELVDGRGRVSARF
GSSPSKAATVRSQPTASAQLEHTEEAPKQVSLALQLPEHSNKDLGNVPGNCSENLCQNGG
TCVPGADTHSCDCGPGFKGRRCELACIKVSRPCTRLFSETKSFPVWEGGVCHHVYKRVYR
VHQDICFKESCESTSLKKTPNRKQSKSQTLEKS
Download sequence
Identical sequences ENSPANP00000010962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]