SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011218 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011218
Domain Number 1 Region: 490-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.54e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 574-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 210-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.6e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 434-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.6e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 5 Region: 266-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 6 Region: 325-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 378-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.15e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 33-93
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-20
Family KRAB domain (Kruppel-associated box) 0.00054
Further Details:      
 
Domain Number 9 Region: 172-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.02e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 616-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-18
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 11 Region: 537-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000575
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 12 Region: 125-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000104
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011218   Gene: ENSPANG00000020662   Transcript: ENSPANT00000025546
Sequence length 675
Comment pep:novel chromosome:PapAnu2.0:19:11284723:11305302:-1 gene:ENSPANG00000020662 transcript:ENSPANT00000025546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPHPKRASRVVVGAVLAAGEVDRTPGHPRVWEMDSVVFEDVAVNFTQEEWALLGPSQK
KLYRDVMQETFVNLASIGENWEEKNTEDHKNQGRKLRSHMVERLCERKEGSQFGETISQT
PNPKPNKKTFTRVKPYECSVCGKDYMCHSSLNRHMRSHTEHRSYEYHKYGEKSYECKECG
KRFSFRSSFRIHERTHTGEKPYKCKQCGKAFSWPSSFQIHERTHTGEKPYECKECGKAFI
YHTTFRGHMRMHTGEKPYKCKECGKTFSHPSSFRNHERTHSGEKPYECKQCGKAFRYYQT
FQIHERTHTGEKPYQCKQCGKALSCPTSFRSHERIHTGEKPYKCKKCGKAFSFPSSFRKH
ERIHTGEKPYDCKECGKAFISLPSYRRHMIMHTGNGPYKCKECGKAFDCPSSFQIHERTH
TGEKPFECKQCGKAFSCSSSFRMHERTHTGEKPHECKQCGKAFSCSSSVRIHERTHTGEK
PYECKQCGKAFSCSSSFRMHERIHTGEKPYECKQCGKAFSFSSSFRMHERTHTGEKPYEC
KQCGKAFSCSSSFRMHERTHTGEKPYECKQCGKAFSCSSSIRIHERTHTGEKPYECKQCG
KAFSCSSSVRMHERTHTGEKPYECKQCDKAFSCSRSFRIHERTHTGEKPYACQQCGKAFK
CSRSFRIHERVHSGE
Download sequence
Identical sequences ENSPANP00000011218 XP_011949347.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]