SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011253 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011253
Domain Number 1 Region: 11-51,179-212
Classification Level Classification E-value
Superfamily RING/U-box 1.45e-19
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 2 Region: 219-271
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000427
Family B-box zinc-binding domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011253   Gene: ENSPANG00000006678   Transcript: ENSPANT00000010218
Sequence length 276
Comment pep:known_by_projection chromosome:PapAnu2.0:6:174344751:174348885:-1 gene:ENSPANG00000006678 transcript:ENSPANT00000010218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGYAPTPSPMQTLQEEAVCAICLDYFKDPVSISCGHNFCRGCVTQLWGKKDEEDRNEEE
DEWEEEEDGEAVGAVDGWDGSIREVLYRGNADEELFQDQEDGELWLGDSGITNWDNGDHM
WDQEEEEEENQDYYLGGLRPDLRIDVYREEEILEAYDEDEDEELYPDIHPSPSSPLPGQF
TCPQCRKSFTRRSFRPNLQLANMVQIIRQMCPTPCRGNRSNDQGMCFKHQEALKLFCEVD
KEAICVVCRESRSHKQHSVVPLEEVVQEYQFVHPMS
Download sequence
Identical sequences A0A096NED6
ENSPANP00000011253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]