SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011348 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011348
Domain Number 1 Region: 310-369
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000398
Family RING finger domain, C3HC4 0.033
Further Details:      
 
Domain Number 2 Region: 96-120
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000366
Family CCCH zinc finger 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000011348
Domain Number - Region: 239-263
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000249
Family CCCH zinc finger 0.0055
Further Details:      
 
Domain Number - Region: 395-424
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000549
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011348   Gene: ENSPANG00000017529   Transcript: ENSPANT00000027091
Sequence length 507
Comment pep:known_by_projection chromosome:PapAnu2.0:7:289284:290804:1 gene:ENSPANG00000017529 transcript:ENSPANT00000027091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPAAPSEAQEAAGAQAGAEAAGEGVSGPDLPVCEPSRESAAPDSALPHAPVGWAPFPV
APVPAHLRTGGLRPAPASGGGAWRNPFPSRSSGIWTKQIICRYYIHGQCKEGENCRYSHD
LSGRKMATEGSVSPPGASAGGGPSTAAHIEPPTQEVAEAPPAASSLSLPVIGSAAERGFF
EAERDNADRGAAGGAGVESWADAIEFVPGQPYRGRWVASAPEAPPQSSETERKQMAVGRG
LRFCYYASRGVCFRGESCMFLHGDICDMCGLQALHPMDAAQREDHIRACIEAHEKDMELS
FAVQRGMDKVCGICMEVVYEKANPNDRRFGILSNCNHTFCIRCIRRWRSARQFDNRIIKS
CPQCRVTSDLVVPSEFWVEEEEEKQKLIQQYKEAMSNKACRYFAEGRGNCPFGDTCFYKH
EYPEGWGDEPPGPGGGSFGAYWHQLVEPVRMGEGDMLYKSRKKELVVLRLASLLFKRFLS
LRDELPFSEDQWDLLHYELEEYFNLNL
Download sequence
Identical sequences XP_011823609.1.47321 ENSPANP00000011348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]