SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011471 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011471
Domain Number 1 Region: 194-272
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.44e-19
Family Middle domain of MutM-like DNA repair proteins 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000011471
Domain Number - Region: 278-320
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0798
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011471   Gene: ENSPANG00000011568   Transcript: ENSPANT00000020019
Sequence length 332
Comment pep:known_by_projection chromosome:PapAnu2.0:8:7140768:7158916:-1 gene:ENSPANG00000011568 transcript:ENSPANT00000020019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPLVRKFHHLISPFVGQQVVKTGGSSKKLQPAGLQSLWLQDTQVHGKKLFLRFDPDE
EMEAPGSSPPPEPPQKEAQKEGAVDPKQAGEPSGQKTPDGSSQSAELNPPGEDESECLEG
DAPAGDAGRWLRVSFGLFGSVWVNEFSRAKKANKRGDWRDPSPRLVLYFGGGGFLAFYNC
QMSWSSSPVVTPACDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEVLYR
AGIHPLSLGSALSAPRREALVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKE
AFGPPGGFQRVTWWCPQCQPQLSEEPEQRQFS
Download sequence
Identical sequences A0A096NEY3
ENSPANP00000011471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]