SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011502 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011502
Domain Number 1 Region: 10-172
Classification Level Classification E-value
Superfamily RUN domain-like 4.32e-40
Family RUN domain 0.00068
Further Details:      
 
Domain Number 2 Region: 1364-1478
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 3.01e-29
Family Supernatant protein factor (SPF), C-terminal domain 0.0012
Further Details:      
 
Domain Number 3 Region: 1170-1235
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.58e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0016
Further Details:      
 
Domain Number 4 Region: 857-1074
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000249
Family Tropomyosin 0.00075
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000011502
Domain Number - Region: 327-555
Classification Level Classification E-value
Superfamily Tropomyosin 0.0719
Family Tropomyosin 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011502   Gene: ENSPANG00000009908   Transcript: ENSPANT00000020515
Sequence length 1480
Comment pep:known_by_projection chromosome:PapAnu2.0:2:89387808:89450745:1 gene:ENSPANG00000009908 transcript:ENSPANT00000020515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTNAESQLQRIIRDLQDAVTELSKEFQEAGEPITDDSTSLHKFSYKLEYLLQFDQKEK
ATLLGNKKDYWDYFCACLAKVKGANDGIRFVKSISELRTSLGKGRAFIRYSLVHQRLADT
LQQCFMNTSIHSDWYYARSPFLQPKLSSDIVGQLYELTEVQFDLASRGYDLDAAWPTFAR
RTLATGSSAYLWKPPSRSSSMSSLVSSYLQTQEMVSNFDLNSPLNNEALEGFDEMRLELD
QLEVREKQLQERMQQLDRENQELRAAVSLQEEQLQTERERGRTAAEDNVHLTCLVAELQK
QWEVTQATQNTVKELQMCLQALELGAAEKEEDYHTALRRLESMLQPLAQELKATRDSLGQ
KNQHLASIPDWLAMARQKADTAPDTKGQQEPIPSDAAREIQELGEKLRALERERTKVEEV
NRQQSAQLEQLVKELQLKEDAWASLERLVKEMAPLQEELSGKGQEADQLWQRLQELLVHS
SSREQELAELRREKKQQQEEKELLEQEVRSLTRQLQFLETQLAQVSQHVSDLEEQKKQLI
QDKDHLSQKVGALERLAGQPGPELPVAGEKNEALVPVNSSLQEACGKPEEEQRGLQEAQL
DDTKVQEGSQEEELRQANRELEKELQNVVGRNQLLEGKLQALQADYQALQQREAAIQGSL
ASLEAEQASIRHLGDQMEASLLAVRKAKEAMKAKVAEKEANLQSKEGECQQLREEVEQCR
QLAEARHRELRALESQCQQQTQLIEVLTAEKGQQGVGPPPDNEARELAAQLALSQAQLEV
HQGEAQRLQAQVVDLQAKMQAALDDQDKVQSQLNMAEAVLREHKTLVQQLKEQNEALNRA
HVQELLQCSEREGALQEERTSEAQQREEELRALQEKLSQAKYSSEEAQLEHAELQEQLHR
ANTDTAELGIQVCTLTMEKEQVEKALACAVQELQDAKEAASREREGLERQVAGLQQEKES
LQEKLKAAKAAADSLPGLQAQLTQAEQQAQSLQEAARQELDTLKFQLSAEIMDYQGRLKN
AGEECRSLRGQLEEQGRQLQAAEEAVGKLKATQADMGEKLSCTSNHLAECQAAMLRKDEE
GAALREDLERTQKELEKATTKIQEYYNKLCKEVTNRERNDQKMLADLDDLNRTKKYLEER
LIELLRARAENHHSQKSDALEFQQKLSAEDRWLGDTEANHCLDCKREFSWMMRRHHCRIC
GRIFCYYCCNNYVLSKHSGKKERCCRACFQKLSEGPGSPDSAGSGTSQGEPSPALSPASP
GPQAIGGQGANTDYRPPDDAVFDIITDEELCQIQESGSSLPETPTETDSLDPNVAEQDTT
STSLTPEDTEDMPVGQDAEICLLKSGELMIKVPLTVDEIASFGEGSRELFVRSSTYSLIP
ITVAEAGLTISWVFSSDPKSISFSVVFQEAEDTPLDQCKVLIPTTRCNSHKENIQGQLKV
RTPGIYMLIFDNTFSRFVSKKVFYHLTVDRPVIYDGSDFL
Download sequence
Identical sequences ENSPANP00000011502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]