SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011589 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011589
Domain Number 1 Region: 250-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000293
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 2 Region: 379-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000837
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 3 Region: 431-478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000949
Family Laminin-type module 0.0063
Further Details:      
 
Domain Number 4 Region: 316-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000165
Family Laminin-type module 0.037
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000011589
Domain Number - Region: 481-516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00014
Family Laminin-type module 0.04
Further Details:      
 
Domain Number - Region: 534-581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000184
Family Laminin-type module 0.032
Further Details:      
 
Domain Number - Region: 962-1050
Classification Level Classification E-value
Superfamily Tropomyosin 0.00327
Family Tropomyosin 0.006
Further Details:      
 
Domain Number - Region: 94-165
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00353
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.071
Further Details:      
 
Domain Number - Region: 835-909
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.011
Family Myosin rod fragments 0.0088
Further Details:      
 
Domain Number - Region: 1017-1146
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0963
Family FCH domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011589   Gene: ENSPANG00000024004   Transcript: ENSPANT00000014030
Sequence length 1172
Comment pep:known_by_projection chromosome:PapAnu2.0:1:154425847:154463308:1 gene:ENSPANG00000024004 transcript:ENSPANT00000014030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLFLLCFALPGLLHAQQACSRGACYPPVGDLLVGRTRFLRASSTCGLTKPETYCTQHG
EWQMKCCKCDSRQPHNYYSHRVENVASSSGPMRWWQSQNDVNPVSLQLDLDRRFQLQEVM
MEFQGPMPAGMLIERSSDFGKTWRVYQYLAADCTSTFPRVRQGRPQSWQDVRCQSLPQRP
NARLNGGKVQLNLMDLASGIPATQSKKIQELGEITNLRVNFTRLAPVPQRGYHPPSAYYA
VSQLRLQGSCFCHGHADRCAPKPGASAGPSTTMQVHDVCVCQHNTAGPNCERCAPFYNNQ
PWRPAEGRDTHECQRCDCNGHSETCHFDPAVFAASQGAYGGVCDNCRDHTEGKNCERCQL
HYFRNRRPGASIQETCIPCECDPDGAVPGAPCDPVTGQCVCKEHVQGERCDLCKPGFTGL
TYANPQGCHRCDCNILGSRRDVLCDEESGRCLCLPNVVGPKCDQCAPYHWKLASGQGCEP
CACDPHNSLSPHCNQFTGQCPCREGFGGLTCSAAAIRQCPDRTYGDAATGCRACDCDFRG
TEGPGCDKASGRCLCHAGLTGPRCDQCQRGYCNRYPVCVACHPCFQTYDADLREQGLRLG
SLRNATASLWSGPGLEDRGLASRILDAKSKIEQIRAVLSSAAVTEQEVAQVASAILSLRR
TLQGLQPDLPLEEETLSLPRDLESLDRSFNGLLTMYQRKREQFEKLSSADPSGAFRMLTT
AYEQSAQAAQQVSDSSHLLDQLRDSRREAERLAQQAGGGGGTGSPQLVALRLEMSSLPDL
TPTFNKLCGSSRQMACTPGSCPGELCPHDNGTACGSHCRGVLPRAGGAFWTAGQVAEQLR
GFNAQLQQTRQMIRAAEESASQIQSNAQRLETQVSTSRSQMEEDVRRTRLLIQQVRDFLT
DPDTDAATIQEVSEAVLALWLPTDSATVLQKMNEIQAIAARLPNVDLVLSQTKQDIARAR
RLQAEAEEARSRAHAVEGQVEDVVGNLRQGTVALQEAQDTMQGTSRSLRLIQDRVAEVQQ
VLQPAEKLVTSMTKQLGDFWTRMEELRRQARQQRAQAVQAQQLAEGASKQALSAQEGFER
IKQKYAELKDRLGQSPTLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAI
MLRSADLTGLEKRVEQIRDHINERVLYYATCK
Download sequence
Identical sequences A0A096NF96
ENSPANP00000011589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]