SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011711 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011711
Domain Number 1 Region: 125-372
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-68
Family Nuclear receptor ligand-binding domain 0.00000000123
Further Details:      
 
Domain Number 2 Region: 57-139
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.87e-29
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011711   Gene: ENSPANG00000001380   Transcript: ENSPANT00000010788
Sequence length 455
Comment pep:known_by_projection chromosome:PapAnu2.0:8:71323357:71350991:1 gene:ENSPANG00000001380 transcript:ENSPANT00000010788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRVSEPILDMDMANYSEVLDPTYTTLEFETMQILYNSNDNSAPETSMNTTDNGVNCLCA
ICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDKRNQCRYCRLRKCF
RAGMKKEAVQNERDRISTRRSTFDGSNIPSINTLAQAEVRSRQISVSSPGSSTDINVKKI
ASIGDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMYKD
ILLLGNNYVIHRNSCEVEISRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGL
SDPVKIKNMRFQVQIGLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFG
MVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPET
PLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL
Download sequence
Identical sequences A0A096NFL0 A0A0D9RLZ4 A0A2K5KPG4
XP_007999118.1.81039 XP_011887296.1.92194 ENSPANP00000011711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]