SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011736 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011736
Domain Number 1 Region: 23-166
Classification Level Classification E-value
Superfamily C-type lectin-like 9.97e-33
Family C-type lectin domain 0.000000648
Further Details:      
 
Domain Number 2 Region: 243-308
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000264
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 3 Region: 369-442
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000104
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 4 Region: 181-246
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000138
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 5 Region: 298-364
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000278
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 6 Region: 431-500
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000514
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 7 Region: 491-552
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000612
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011736   Gene: ENSPANG00000007869   Transcript: ENSPANT00000005809
Sequence length 614
Comment pep:known_by_projection chromosome:PapAnu2.0:1:192621796:192632719:-1 gene:ENSPANG00000007869 transcript:ENSPANT00000005809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIASQFLSALTLVVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYL
NSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKRD
KDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLECEQIVN
CTALESPEHGSLVCSHPLGNFSYSSSCSVSCDRGYLPSSVETTQCMSSGEWSAPVPACKV
VECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTC
KAVTCRAIRQPQNGSVRCSHSPAGEFTFKSSCSFTCEEGFMLQGAAQVECTTQGQWTQQV
PVCEGLSFQCTALSNPEHGYMNCLPSASGSFRNGSSCEFSCEQGFVLKGSKRLQCGPTGE
WDNEKPTCEAVRCDAVHQPQRGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTS
QGQWTEEVPSCQVVKCSSLAVLEKINMSCSGEPVFGTVCNFACPEGWRLNGSAAMTCGAT
GHWSGMLPTCEAPTESNTPLVAGLSAAGLSLLTLAPFLLWLRKCFRKAAKKFVPASSCQS
LESDGSYQKPSYIL
Download sequence
Identical sequences ENSPANP00000011736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]