SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011761 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011761
Domain Number 1 Region: 99-213
Classification Level Classification E-value
Superfamily PX domain 0.0000000000000105
Family PX domain 0.0036
Further Details:      
 
Domain Number 2 Region: 295-349
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000293
Family SAM (sterile alpha motif) domain 0.0059
Further Details:      
 
Domain Number 3 Region: 870-900
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000384
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011761   Gene: ENSPANG00000022199   Transcript: ENSPANT00000006518
Sequence length 924
Comment pep:known_by_projection chromosome:PapAnu2.0:20:69124602:69210719:-1 gene:ENSPANG00000022199 transcript:ENSPANT00000006518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNHPAFSFHQKQVLRQELTQIQSSLNGGGGHGGKGAPGPGGALPTCPACHKITPRTEA
PVSSVSNSLENALHTSAHSTEESLPKRPLGKHSKAVSVEKIDLKGLSHTKNDRNVECSFE
VLWSDSSITSVTKSSSEVTEFISKLSQLYPEENLEKLIPCLAGPDAFYVERNHVDLDSGL
RYLASLPSHVLKNDHVRRFLSTSQLQSPSPGNPSLSKVGTVMGVSGRPVCGVAGIPSSQS
GAQHHGQHPAGSAAPLPHCSHAGSAGSALAYRTQMDTSPAILMPSSLQTPQTQEQNGILD
WLRKLRLHKYYPVFKQLSMEKFLSLTEEDLNKFESLTMGAKKKLKTQLELEKEKSERRCL
NPSAPSLVTSSGVARVPPTSHVGPVQSGRGSHAAELRVEVEQPHHQLPREGSSSEYSSSS
SSPMGVQAREESSDSAEENDRRVEIHLESSDKEKPVMLLNHFTSSSARPTAQVLPVQNEA
SSNPSGHHPLPPQMLSTASHIAPIRMLNSVHKPERGSADMKLLSSSVHSLLSLEERNKGS
GPRSSMKVDKSFGSAMMDVLPASAPHQPVQVLSGLSESSSMSPTVSFGPRAKVVHASTLD
RVLKTAQQPALVVETSTAATGTPSTVLHAARPPIKLLLSSSVPADSAISGQTSCPNNVQI
SVPPAIINPRTALYTANTKVAFSAMSSMPVGPLQGGFCANSNTASPSSHPSTSFANMATL
PSCPAPSSSPALSSVPESSFYSNSGGGGSTGNIPASNPGCIVCTSCGCSGSCGSSGLTVS
YANYFQHPFSGPSVFTFPFLPFSPMCSSGYVSAQQYGGGSTFPVVHAPYSSSGTPDPVLS
GQSTFAVPPMQNFMAGTAGVYQTQGLVGSSNGSSHKKSGNLSCYNCGATGHRAQDCKQPS
MDFNRPGTFRLKYAPPAESLDSTD
Download sequence
Identical sequences ENSPANP00000011761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]