SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011827 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011827
Domain Number 1 Region: 83-234
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-32
Family Pleckstrin-homology domain (PH domain) 0.000089
Further Details:      
 
Domain Number 2 Region: 4-36
Classification Level Classification E-value
Superfamily WW domain 0.000000017
Family WW domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011827   Gene: ENSPANG00000018146   Transcript: ENSPANT00000001417
Sequence length 1222
Comment pep:known_by_projection chromosome:PapAnu2.0:14:47947427:48178627:1 gene:ENSPANG00000018146 transcript:ENSPANT00000001417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRSDLPRGWEEGFTEEGASYFIDHNQQTTAFRHPVTGQFSPENSEFILQEEPNPHMSKQ
ERNQRPSSMVSETSTAGTASTLEAKPGPKIIKSSNKVHSFGKRDQAIRRNPNVPVVVRGW
LHKQDSSGMRLWKRRWFVLADYCLFYYKVKDSREEAVLGSIPLPSYVISPVAPEDRISRK
YSFKAVHTGMRALIYNSSTAGSQAEQSGMRTYYFSADTQEDMNAWVRAMNQAAQVLSRSS
LKRDMEKVERQAVPQANHTESCHECGRVGPGHTRDCSHRGHDDTVNFERQEQEGEQYRSQ
RDPLEGKRDRSKARSPYSPAEEDALFMDLPSGPRGQQAQPQRAEKNGMLPASYGPGEQNG
TGGYQRAFPPRTNPEKHSQRKSNLAQVEHWARAQKGDSRSLPLDQTLPRQGPGQSLSFPE
NYQTLPRSTRHPSGGSSPPPRNLPSDYKYAQDRASHLKMSSEERRAHRDGTVWQLYEWQQ
RQQFRHGSPTAPICLGSPEFTDQGRSRSMLEVPRSISVPPSPSDIPPPPPRVFPPRRPHT
PAERVTVKPPDQRRSVDISLGDSPRKARGHAVKNSSHVDRRSMPSMGYMTHTVSAPSLHG
KSADDTYLQLKKDLEYLDLKMTGRDLLKDRSLKPVKIAESDIDVKLSIFCEQDRILQDLE
DKIRALKENKDQLESVLEVLHRQMEQYRDQPQHLEKIAYQQKLLQEDLVHIRAELSREST
EMENAWNEYLKLENDVEQLKQTLQEQHRRSFFVSEKSQIQKDLWRIEDVTAGLSANKENF
RILVESVKNPERKTVPLFPHPPVPSLSTSESKPPPQPSPPTSPVRTPLEVRLFPQLQTYV
PYRPHPPQLRKVTSPLQSPTKTKPKVEDEAPPRPPLPELYSPEDQPPAVPPLPREATIIR
HTSVRGLKRQSDERKRDRELGQCVNGDSRVELRSYVSEPELATLSGDMAQPSLGLVGPES
RYQTLPGRGLSGSMSRLQQSSTIAPYVTLRRGLNAESSKATFPRPKSALERLYSGDHQRG
KMSAEEQLERMKRHQKALVRERKRTLGQGERMGLPSSRYLSRPLPGDLGSWKREQDFDLQ
LLERVVQGEKKDKEENGWLKVQAMPVTELDLEPQDYDLDISRELSKPEKVSIPERYVELD
PEEPPSLEELQARYRKAEKIRNILARSSMCNLQPTSGQDRNSVADLDLQLQEQERIINIS
YALASEASQRSKQVAGKAMAQP
Download sequence
Identical sequences ENSPANP00000011827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]